Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_085771844.1 B1812_RS12255 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_002117405.1:WP_085771844.1 Length = 397 Score = 349 bits (895), Expect = e-100 Identities = 185/392 (47%), Positives = 255/392 (65%), Gaps = 2/392 (0%) Query: 5 TIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPK 64 T+ DLKGKRV++RVD NVP++ G + D TRI LPTIK ++G KVILL+H GRPK Sbjct: 6 TLDHADLKGKRVLLRVDLNVPMEGGHITDATRIDRVLPTIKEIADKGGKVILLAHFGRPK 65 Query: 65 GEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGET 124 G + E +L PVA L+E L + V F VG ++A+ LK+G+VLLLENTRFH GE Sbjct: 66 GARNDEDTLKPVAAALAEHLRRPVAFADDCVGPPAQEAIAALKDGDVLLLENTRFHKGEE 125 Query: 125 KNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTYN 184 KNDP A+ A+L D++VNDAF AHRAHAS G+A +P+ AG M+ E++ L + Sbjct: 126 KNDPAFAEELANLGDLYVNDAFSAAHRAHASTEGLAHKLPAYAGRAMQAELEALEQALGA 185 Query: 185 PEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKID 244 P++P + ++GGAK+S K+ ++ NL+ K D ++IGG M TFL A GK VG S E +D Sbjct: 186 PQRPVMAIVGGAKISTKLDLLGNLVSKVDYLVIGGGMANTFLAAQGKAVGKSLCETSLLD 245 Query: 245 LAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIELF 304 A+E++ KAK G +IVLP D +A + VV D P+ M LD+GP+ + Sbjct: 246 TAREIMSKAKAAGCQIVLPEDVTVALTFKSHAPAHVVSADHVGPQE-MILDVGPKAVAHV 304 Query: 305 KQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKG-AITVVGGGDSAAAVNKF 363 + L KT+VWNGP G FE+ F EGT VA A LT +G ++V GGGD+ +A+N+ Sbjct: 305 EGLLEKCKTLVWNGPFGAFELPPFDEGTSAVAQTAARLTVEGKLLSVAGGGDTVSALNQA 364 Query: 364 GLEDKFSHVSTGGGASLEFLEGKELPGIASIA 395 +F++VST GGA LE+LEGKELPG+ +++ Sbjct: 365 HAAQQFTYVSTAGGAFLEWLEGKELPGVKALS 396 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 606 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 397 Length adjustment: 34 Effective length of query: 620 Effective length of database: 363 Effective search space: 225060 Effective search space used: 225060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory