Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; EC 1.1.1.138 (characterized)
to candidate WP_085770215.1 B1812_RS02625 acetoacetyl-CoA reductase
Query= SwissProt::O93868 (262 letters) >NCBI__GCF_002117405.1:WP_085770215.1 Length = 241 Score = 129 bits (325), Expect = 4e-35 Identities = 86/251 (34%), Positives = 134/251 (53%), Gaps = 14/251 (5%) Query: 10 VNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAKDAVEVTEKVGKEFGVKTKAYQCD 69 +++T +VTGG RGIG A ++A+ AAG VA Y +A + K +E G+ ++ D Sbjct: 1 MSRTAVVTGGTRGIGEAISKALKAAGYKVAATYAGNDEAAK---KFKEETGIAV--FKFD 55 Query: 70 VSNTDIVTKTIQQIDADLGAISGLIANAGVSVVKPATELTHEDFKFVYDVNVFGVFNTCR 129 VSN D I I+ +LG + L+ NAG++ ++T E + V N+ +FN R Sbjct: 56 VSNYDACVAGIAAIEKELGPVEILVNNAGITKDGLFHKMTLEQWNAVIGTNLNSLFNVTR 115 Query: 130 AVAKLWLQKQQKGSIVVTSSMSSQIINQSSLNGSLTQVFYNSSKAACSNLVKGLAAEWAS 189 V ++ + G I+V SS++ Q G Q Y++SKA VK LA E AS Sbjct: 116 PVIN-GMRDRGFGRIIVISSINGQ-------KGQAGQTNYSASKAGDIGFVKALAQESAS 167 Query: 190 AGIRVNALSPGYVNTDQTAHMDKKIRDHQ-ASNIPLNRFAQPEEMTGQAILLLSDHATYM 248 G+ VNA++PGY+ T+ + ++I D +I + R +PEE+ + L SD A ++ Sbjct: 168 KGVTVNAIAPGYIATEMVKAVPQEILDKNIIPHIAVKRLGEPEEIARAVVFLASDDAGFI 227 Query: 249 TGGEYFIDGGQ 259 TG I+GGQ Sbjct: 228 TGSTLTINGGQ 238 Lambda K H 0.317 0.130 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 241 Length adjustment: 24 Effective length of query: 238 Effective length of database: 217 Effective search space: 51646 Effective search space used: 51646 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory