Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate WP_085771912.1 B1812_RS12645 LPS export ABC transporter ATP-binding protein
Query= CharProtDB::CH_003736 (237 letters) >NCBI__GCF_002117405.1:WP_085771912.1 Length = 288 Score = 138 bits (348), Expect = 1e-37 Identities = 80/234 (34%), Positives = 127/234 (54%), Gaps = 3/234 (1%) Query: 5 MLSFDKVSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVF 64 +L+ ++ Y + + +VSLH+ +GE V L+G NGAGKTT+ + G + SGRI Sbjct: 51 VLAIHNLAKSYKTRRVVEDVSLHVRRGEAVGLLGPNGAGKTTVFYMITGLVKPDSGRITL 110 Query: 65 DDKDITDWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGFFAERDQFQ--ERIKWVYE 122 D D+T + R + +P+ VF +TVEEN+ E D+ + E++ + E Sbjct: 111 DGYDVTPLPMYRRARLGIGYLPQEMSVFRGLTVEENILAVLEIVEPDKKKRAEQLDGLLE 170 Query: 123 LFPRLHERRIQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTIEQ 182 F H R+ A +SGGE++ I RA+ P +LLDEP G+ PI I I D + Sbjct: 171 EFRLAHLRKTP-AIAVSGGERRRCEIARAIAGRPSFMLLDEPFAGIDPIAIGGIQDLVRH 229 Query: 183 LREQGMTIFLVEQNANQALKLADRGYVLENGHVVLSDTGDALLANEAVRSAYLG 236 L+++G+ + + + + + L L DR Y++ NGHV+ ++AN VR YLG Sbjct: 230 LKQRGIGVLITDHSVRETLGLTDRAYIIYNGHVLTEGAPAEIVANPDVRRIYLG 283 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 288 Length adjustment: 25 Effective length of query: 212 Effective length of database: 263 Effective search space: 55756 Effective search space used: 55756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory