Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_245300279.1 B1812_RS18275 sulfate/molybdate ABC transporter ATP-binding protein
Query= uniprot:D8J1T6 (255 letters) >NCBI__GCF_002117405.1:WP_245300279.1 Length = 353 Score = 114 bits (286), Expect = 2e-30 Identities = 77/232 (33%), Positives = 116/232 (50%), Gaps = 15/232 (6%) Query: 15 FGGLQALNGVGITIERGQIYGLIGPNGAGKTTFFNVITGLYQPDTGTFELDGKPYSPSAP 74 FG AL V + I G++ L+GP+G+GKTT VI GL P G D + + Sbjct: 8 FGSYPALRDVSLDIAGGELVALLGPSGSGKTTLLRVIAGLNSPHRGAVFFDALNATSLS- 66 Query: 75 HEVAKAGIARTFQNIRLFGEMTVLENVMVGCHVRTKQNVFGAVFRHKAAREEEAAIREKS 134 V + + FQN LF M+V +NV FG R +A+R + I + Sbjct: 67 --VQERRVGFVFQNYALFKHMSVADNV-----------AFGLKARPRASRPPKREIAARV 113 Query: 135 QKLLDFVGIGQFAKRTARHLSYGDQRRLEIARALATDPQLLALDEPAAGMNATEKLGLRE 194 +LL+ V + +R LS G ++R+ +ARALA +P++L LDEP ++A + LR Sbjct: 114 AELLELVQLEGLGQRYPAQLSGGQRQRVALARALAIEPRVLLLDEPFGALDARVRKDLRR 173 Query: 195 LLVKI-QAEGKTILLIEHDVKLMMGLCNRITVLDYGKPIAEGVPADVQKNPA 245 L +I + G T + + HD M L +R+ VL+ G+ G PA + PA Sbjct: 174 WLREIHKRTGLTTVFVTHDQDEAMELADRVVVLNQGRIEQAGSPAALYDRPA 225 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 353 Length adjustment: 27 Effective length of query: 228 Effective length of database: 326 Effective search space: 74328 Effective search space used: 74328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory