Align AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate WP_245300279.1 B1812_RS18275 sulfate/molybdate ABC transporter ATP-binding protein
Query= TCDB::Q52815 (257 letters) >NCBI__GCF_002117405.1:WP_245300279.1 Length = 353 Score = 146 bits (368), Expect = 7e-40 Identities = 77/221 (34%), Positives = 129/221 (58%), Gaps = 8/221 (3%) Query: 27 YGDFHVLRDINLKVMRGERIVIAGPSGSGKSTMIRCINRLEEHQKGKIVVDGTELTNDLK 86 +G + LRD++L + GE + + GPSGSGK+T++R I L +G + D T+ Sbjct: 8 FGSYPALRDVSLDIAGGELVALLGPSGSGKTTLLRVIAGLNSPHRGAVFFDALNATS--- 64 Query: 87 KIDEVRREVGMVFQHFNLFPHLTILENCTL---APIWVRKMPKKQAEEVAMHFLKRVKIP 143 + R VG VFQ++ LF H+++ +N A + PK++ L+ V++ Sbjct: 65 -LSVQERRVGFVFQNYALFKHMSVADNVAFGLKARPRASRPPKREIAARVAELLELVQLE 123 Query: 144 EQANKYPGQLSGGQQQRVAIARSLCMNPKIMLFDEPTSALDPEMIKEVLDTMVGLAEE-G 202 +YP QLSGGQ+QRVA+AR+L + P+++L DEP ALD + K++ + + + G Sbjct: 124 GLGQRYPAQLSGGQRQRVALARALAIEPRVLLLDEPFGALDARVRKDLRRWLREIHKRTG 183 Query: 203 MTMLCVTHEMGFARQVANRVIFMDQGQIVEQNEPAAFFDNP 243 +T + VTH+ A ++A+RV+ ++QG+I + PAA +D P Sbjct: 184 LTTVFVTHDQDEAMELADRVVVLNQGRIEQAGSPAALYDRP 224 Score = 29.6 bits (65), Expect = 9e-05 Identities = 26/99 (26%), Positives = 43/99 (43%), Gaps = 4/99 (4%) Query: 1 MAEAPAKKLTVSATEVAVEIVNMNKWYGDFHVLRDINLKVM-RGERIVIAGPSGSGKSTM 59 + EA A +TV V++ + + D H LRD +V R I IAG S Sbjct: 233 VGEAVALPVTVKQGHVSL---GGRELHVDAHNLRDGQARVFFRPADIAIAGAGPSALEGR 289 Query: 60 IRCINRLEEHQKGKIVVDGTELTNDLKKIDEVRREVGMV 98 + + R + I +DG++ ++ + E EVG + Sbjct: 290 VEALRRTPSGVRATISIDGSDQRLEIDQALENAAEVGAI 328 Lambda K H 0.321 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 257 Length of database: 353 Length adjustment: 27 Effective length of query: 230 Effective length of database: 326 Effective search space: 74980 Effective search space used: 74980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory