Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate WP_085772003.1 B1812_RS13165 acetyl-CoA C-acetyltransferase
Query= BRENDA::Q0KAI3 (392 letters) >NCBI__GCF_002117405.1:WP_085772003.1 Length = 402 Score = 271 bits (693), Expect = 2e-77 Identities = 162/405 (40%), Positives = 230/405 (56%), Gaps = 16/405 (3%) Query: 1 MQQAVIVDAIRSPMGRSKPGSAFTELHATELLAQVIKGLVERNKLDPGLVDDVITGCVTQ 60 M A I DA+R+P GR K + E+ + + + RN L VDDV+ GCV Sbjct: 1 MTDAYIYDAVRTPRGRGKVDGSLHEVSTLGIAVTALAAIKSRNGLAGSEVDDVVFGCVDP 60 Query: 61 AGEQSAGPGRVAWLAAGFPDHVPATTIDRKCGSSQQAVHFAAQGIMAGAYDIVIACGIES 120 GE R LAAGF D VP I+R C S AV+FAA IM+G +++ I G+ES Sbjct: 61 VGEAGGDIARAGALAAGFGDKVPGVQINRFCASGLDAVNFAAAEIMSGQHELTIGGGVES 120 Query: 121 MSRVPMGSARIGQNPYGPSMEARYAPGLVSQGVAAELVAAKYELSRHDMDSYSARSHELA 180 MSRV +G++ G P P++ + QGV+A+L+A KY SR D+D+Y+ +S + A Sbjct: 121 MSRVGIGASG-GAWPVDPAIAI--PSYFMPQGVSADLIATKYGFSRDDVDAYAVQSQKRA 177 Query: 181 ATARESGAFRREILGISTPNGL--VEQDETIRPGTSVEKLGTLQASFRNDELSARFPQIG 238 A A E F R I + NGL +++DE +RP T ++ L +L+ SF F + Sbjct: 178 ARAWEEKRFARSIAPVKDVNGLTILDRDEHMRPETDMQGLASLKPSFVMLAEMGGFDAVA 237 Query: 239 WNVT-----------AGNASQISDGASAMLLMSESMAQRLGLKPRARFVAFDVCGDDPVM 287 AGN+S I DGA+A+L+ S QRLG+KPRA+ AF G +P M Sbjct: 238 IQAHPEIEAVNHVHHAGNSSGIVDGAAAVLVGSREAGQRLGVKPRAKIRAFANIGSEPAM 297 Query: 288 MLTAPIPASQRAIKKSGLKLDQIDHYEINEAFACVPLAWQRALGADPARLNPRGGAIALG 347 MLT P+ +++ + ++ ++L I+ +E+NEAFA V L + +A DP ++N GGAIALG Sbjct: 298 MLTGPMDVTRKLLARAKMRLADIELFEVNEAFAAVVLRYLQAFDLDPEKVNVNGGAIALG 357 Query: 348 HPLGASGVRLMTTMLHALEDSGQRYGLQSMCEAGGMANATIIERL 392 HPLGA+G L+ T L LE SG+ L ++C GM ATIIER+ Sbjct: 358 HPLGATGAMLLGTALDELERSGKSVALVTLCIGAGMGTATIIERV 402 Lambda K H 0.318 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 402 Length adjustment: 31 Effective length of query: 361 Effective length of database: 371 Effective search space: 133931 Effective search space used: 133931 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory