Align 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 (characterized)
to candidate WP_245300308.1 B1812_RS21480 diaminobutyrate--2-oxoglutarate transaminase
Query= SwissProt::P50457 (421 letters) >NCBI__GCF_002117405.1:WP_245300308.1 Length = 454 Score = 205 bits (521), Expect = 3e-57 Identities = 144/415 (34%), Positives = 210/415 (50%), Gaps = 28/415 (6%) Query: 15 PRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTH 74 PRG+ + +S ++DVE EYID +G GH H +V AV L Sbjct: 27 PRGLPIAL----KSGGGVRVRDVEDREYIDCLSGAGTQPLGHNHEVVVDAVRDALSGAVP 82 Query: 75 TAYQIVPY---ESYV-TLAEKINALAPVSGQAKTAFF-TTGAEAVENAVKIARAHTGRPG 129 +P + ++ L + + A P K F +GA+A+E A+K+ R TGR G Sbjct: 83 LQTLDLPTPLKDRFIGDLFDSLPAEFP--NNFKIQFCGPSGADAIEAALKLVRTATGRRG 140 Query: 130 VIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLH-------GISTQDS 182 +++F G +HG T ++LTG+ P K V +PYPSD ++ S Sbjct: 141 ILSFRGAYHGMTSGALSLTGESGP-KAAINGGAAEVQFLPYPSDYRCPFGLGGHAGSEMS 199 Query: 183 LDAIERLFKSDIEAKQV-AAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQ 241 IE L + + + AA+I E VQGEGG N AP + IR + + GI +I DEVQ Sbjct: 200 ARYIENLLEDPLSGVPLPAAMILEVVQGEGGINPAPDSWLRKIREITEFRGIPLILDEVQ 259 Query: 242 SGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGNP 301 +G RTG+L+A H PD++ ++K++ GG+PLS V+ +D PG GT+ GN Sbjct: 260 TGLGRTGRLYAFQHAGITPDVLVLSKAIGGGLPLSVVIYRRE-LDHWQPGAHAGTFRGNQ 318 Query: 302 LAVAAAHAVLNIIDKESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEF--- 358 LA AA A + I + L A ++G RL++ L + I VRG G M+ VE Sbjct: 319 LAFAAGAATIRFISAQRLECNAEEMGCRLQDALRSIQSETRCIGHVRGRGLMVGVEIVRA 378 Query: 359 --NDPQTGEPSAA--IAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFD 409 D G PS++ +AQK+Q L +GL+L G G+VIRFL PL + A+ D Sbjct: 379 DHTDRLAGPPSSSPQMAQKLQNECLRRGLILERGGRLGSVIRFLPPLIVTPAEID 433 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 509 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 421 Length of database: 454 Length adjustment: 32 Effective length of query: 389 Effective length of database: 422 Effective search space: 164158 Effective search space used: 164158 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory