Align 4-(gamma-glutamylamino)butanal dehydrogenase (EC 1.2.1.99) (characterized)
to candidate WP_085772038.1 B1812_RS13395 aldehyde dehydrogenase family protein
Query= BRENDA::P23883 (495 letters) >NCBI__GCF_002117405.1:WP_085772038.1 Length = 506 Score = 337 bits (864), Expect = 6e-97 Identities = 194/492 (39%), Positives = 289/492 (58%), Gaps = 20/492 (4%) Query: 15 SLAIENRL--FINGEYTAAAENETFETVDPVTQAPLAKIARGKSVDIDRAMSAARGVFER 72 S+AI+ R FI G++ A E F+ + P+T P+ ++ARG++ D++ A+ AA + Sbjct: 12 SVAIKKRYDNFIGGQWVAPLGGEYFDNISPITGHPICQVARGRAADVELALDAAHKA--K 69 Query: 73 GDWSLSSPAKRKAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYA 132 W + A+R +LNK+A ++ + LAL+ET+D GKPIR + DIP A R++A Sbjct: 70 DAWGKTPAAERANMLNKIAQRLDDNLSALALVETIDNGKPIRETTAADIPLAIDHFRYFA 129 Query: 133 EAIDKVYGEVATTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKP 192 + G ++ +A EP+GV+ I+PWNFP+L+ WKL PALAAGN V+LKP Sbjct: 130 GCLRAQEGSLSEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLSPALAAGNCVVLKP 189 Query: 193 SEKSPLSAIRLAGLAKEAGLPDGVLNVVTGFGHEAGQALSRHNDIDAIAFTGSTRTGKQL 252 +E++P+S + +A L + LP GVLN+V GFG EAG+ L+ + I IAFTG T TG+ + Sbjct: 190 AEQTPMSILAVAELIADL-LPPGVLNIVNGFGVEAGKPLASNKRIAKIAFTGETTTGRLI 248 Query: 253 LKDAGDSNMKRVWLEAGGKSANIVFADCPDLQQA----ASATAAGIFYNQGQVCIAGTRL 308 ++ A + N+ V LE GGKS NI FAD A A A NQG+VC +R Sbjct: 249 MQYAAE-NLIPVTLELGGKSPNIFFADVMAEDDAFLDKALEGFASFALNQGEVCTCPSRA 307 Query: 309 LLEESIADEFLALLKQQAQNWQPGHPLDPATTMGTLIDCAHADSVHSFIREGESKG-QLL 367 L++ SI D+F+ + + GHPLDPAT +G + + S++ G +G ++L Sbjct: 308 LVQRSIYDKFMEKALARVAKIRQGHPLDPATMIGAQASNDQLEKILSYVDIGRKEGAKVL 367 Query: 368 LDGRNAGLAAAIGPTIFVDVDPNA-------SLSREEIFGPVLVVTRFTSEEQALQLAND 420 + G + L + + + P A + +EEIFGPV+ VT F +EE+ALQ+AND Sbjct: 368 IGGERSVLEGELKEGYY--MQPTALEGHNRMRVFQEEIFGPVVSVTTFETEEEALQIAND 425 Query: 421 SQYGLGAAVWTRDLSRAHRMSRRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHAL 480 + YGLGA +WTRD SRA+R R ++AG V+ N Y+ FGGYKQSG GR+ L Sbjct: 426 TLYGLGAGLWTRDGSRAYRCGRAIRAGRVWTNCYHAYPAHAAFGGYKQSGIGRENHKMML 485 Query: 481 EKFTELKTIWIS 492 + + + K + +S Sbjct: 486 DHYQQTKNLLVS 497 Lambda K H 0.317 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 532 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 506 Length adjustment: 34 Effective length of query: 461 Effective length of database: 472 Effective search space: 217592 Effective search space used: 217592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory