Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_245300279.1 B1812_RS18275 sulfate/molybdate ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_002117405.1:WP_245300279.1 Length = 353 Score = 112 bits (279), Expect = 1e-29 Identities = 75/230 (32%), Positives = 110/230 (47%), Gaps = 15/230 (6%) Query: 14 GISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFELAGKPY 73 G+ FG AL DV + I G++ L+GP+G+GKTT VI GL +P G Sbjct: 3 GVELDFGSYPALRDVSLDIAGGELVALLGPSGSGKTTLLRVIAGLNSPHRGAVFFDALNA 62 Query: 74 EPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFKAEEAA 133 +V E + FQN LF M+ +NV FG R + + + Sbjct: 63 TSLSVQE---RRVGFVFQNYALFKHMSVADNV-----------AFGLKARPRASRPPKRE 108 Query: 134 IAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGMNATEK 193 IA R ELL+ V + LS G ++R+ +ARALA +P+++ LDEP ++A + Sbjct: 109 IAARVAELLELVQLEGLGQRYPAQLSGGQRQRVALARALAIEPRVLLLDEPFGALDARVR 168 Query: 194 VQLRELIDRI-RNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPA 242 LR + I + T + + HD M L DRV VL+ G+ G+PA Sbjct: 169 KDLRRWLREIHKRTGLTTVFVTHDQDEAMELADRVVVLNQGRIEQAGSPA 218 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 353 Length adjustment: 27 Effective length of query: 233 Effective length of database: 326 Effective search space: 75958 Effective search space used: 75958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory