Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_245300279.1 B1812_RS18275 sulfate/molybdate ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1302 (334 letters) >NCBI__GCF_002117405.1:WP_245300279.1 Length = 353 Score = 189 bits (479), Expect = 1e-52 Identities = 105/234 (44%), Positives = 136/234 (58%), Gaps = 4/234 (1%) Query: 6 LESVTKNFGPVEVIPPLDLTIEDGEFTVFVGPSGCGKSTLLRLIAGLEDITSGTIRIDGE 65 +E V +FG + + L I GE +GPSG GK+TLLR+IAGL G + D Sbjct: 1 MEGVELDFGSYPALRDVSLDIAGGELVALLGPSGSGKTTLLRVIAGLNSPHRGAVFFDAL 60 Query: 66 DATNIPPAKRGLAMVFQSYALYPHMSVRKNIAFPMKMAGIPADEQKRRIDNAAAAL---- 121 +AT++ +R + VFQ+YAL+ HMSV N+AF +K + KR I A L Sbjct: 61 NATSLSVQERRVGFVFQNYALFKHMSVADNVAFGLKARPRASRPPKREIAARVAELLELV 120 Query: 122 NLTDYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVGMRLEISELHK 181 L R P QLSGGQRQRVA+ RA+ EP L DEP LDA +R +R + E+HK Sbjct: 121 QLEGLGQRYPAQLSGGQRQRVALARALAIEPRVLLLDEPFGALDARVRKDLRRWLREIHK 180 Query: 182 RLATTMIYVTHDQVEAMTMADKIVVLQAGVIEQVGSPMELYRAPRNVFVAGFIG 235 R T ++VTHDQ EAM +AD++VVL G IEQ GSP LY P + FV F+G Sbjct: 181 RTGLTTVFVTHDQDEAMELADRVVVLNQGRIEQAGSPAALYDRPASAFVLSFVG 234 Lambda K H 0.320 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 353 Length adjustment: 29 Effective length of query: 305 Effective length of database: 324 Effective search space: 98820 Effective search space used: 98820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory