Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_085770215.1 B1812_RS02625 acetoacetyl-CoA reductase
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_002117405.1:WP_085770215.1 Length = 241 Score = 131 bits (330), Expect = 1e-35 Identities = 88/238 (36%), Positives = 129/238 (54%), Gaps = 8/238 (3%) Query: 19 RHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAARELDG-TFERLNVTDADA- 76 R A+VTGG +GIG I++ L AG +V D +E G + +V++ DA Sbjct: 3 RTAVVTGGTRGIGEAISKALKAAGYKVAATYAGNDEAAKKFKEETGIAVFKFDVSNYDAC 62 Query: 77 ---VADLARRLPDVDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGVFWCCREFGRTML 133 +A + + L V++LVNNAGI ++ + W AV+ NL+ +F R M Sbjct: 63 VAGIAAIEKELGPVEILVNNAGITKDGLFHKMTLEQWNAVIGTNLNSLFNVTRPVINGMR 122 Query: 134 ARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRGVRVNAVAPGYT 193 RG G I+ +S++G Q Y+ASKA I ++LA E AS+GV VNA+APGY Sbjct: 123 DRGFGRIIVISSING--QKGQAGQTNYSASKAGDIGFVKALAQESASKGVTVNAIAPGYI 180 Query: 194 ATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYLASDAASFVTGHTLVVDGG 251 AT + + + + + + RL EP EIA AV++LASD A F+TG TL ++GG Sbjct: 181 ATEMV-KAVPQEILDKNIIPHIAVKRLGEPEEIARAVVFLASDDAGFITGSTLTINGG 237 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 241 Length adjustment: 24 Effective length of query: 231 Effective length of database: 217 Effective search space: 50127 Effective search space used: 50127 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory