Align Fructokinase; D-fructose kinase; Manno(fructo)kinase; EC 2.7.1.4 (characterized)
to candidate WP_085770628.1 B1812_RS05150 ROK family protein
Query= SwissProt::P23917 (302 letters) >NCBI__GCF_002117405.1:WP_085770628.1 Length = 304 Score = 304 bits (778), Expect = 2e-87 Identities = 151/299 (50%), Positives = 193/299 (64%), Gaps = 3/299 (1%) Query: 1 MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIATLVDMAEQATGQRGTV 60 +R+G+DLGGTKTE IA+ +G L R R+PTP DY + TI LV E G V Sbjct: 6 LRVGVDLGGTKTEAIAIDPSGAMLLRRRVPTPASDYAAILTTIVALVHAIEAELGGVARV 65 Query: 61 GMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDGAAA 120 G+G+PG ISP +G ++N+N+ LN +PF KDL L RE R+ NDANC A+SEA DGAA Sbjct: 66 GVGVPGWISPRSGFIRNSNTLVLNQRPFAKDLEQALARETRIENDANCFALSEATDGAAQ 125 Query: 121 GAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYREEVPCYCGK 180 G VF VI+GTG G G+ G G N AGEWGHNPLP M DE CYCG+ Sbjct: 126 GRDVVFGVILGTGVGGGLTLRGALLRGANAIAGEWGHNPLPRMSPDEF---PGPRCYCGR 182 Query: 181 QGCIETFISGTGFAMDYRRLSGHALKGSEIIRLVEESDPVAELALRRYELRLAKSLAHVV 240 GCIETF+ G A+ Y SG ++ E+ R + + +A AL Y RLA++LA VV Sbjct: 183 MGCIETFLCGGALALRYGEKSGESVGAEEVARRADHGEALALDALDSYRDRLARALASVV 242 Query: 241 NILDPDVIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPVRKAKHGDSSGVRGAAWLW 299 NI+DPD+IVLGGG+SN+DRLY+ + +L+ + F TP+ + +HGDSSGVRGAAWLW Sbjct: 243 NIVDPDMIVLGGGVSNIDRLYEGLEKLVGDYAFTDALATPIVRNRHGDSSGVRGAAWLW 301 Lambda K H 0.318 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 304 Length adjustment: 27 Effective length of query: 275 Effective length of database: 277 Effective search space: 76175 Effective search space used: 76175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory