Align methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate WP_085771613.1 B1812_RS10880 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::P42412 (487 letters) >NCBI__GCF_002117405.1:WP_085771613.1 Length = 484 Score = 234 bits (598), Expect = 4e-66 Identities = 143/469 (30%), Positives = 237/469 (50%), Gaps = 6/469 (1%) Query: 11 INGEWVESKTDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTWSKVAVPRRAR 70 I+G WV++ + V++PAT L + P + A + AA AF +W +RA Sbjct: 15 IDGHWVQADSGARFPVLDPATGATLEEAPDMGAAETRRAIEAAARAFSSWRATPAKQRAA 74 Query: 71 ILFNFQQLLSQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAAGAPSLMMGDSLASI 130 I+ + +L+ +E LA ++T E GK EA GE+ G +++ A + GD L Sbjct: 75 IMRRWFELILAEQESLAQILTAEQGKPLAEARGEIAYGATYIDWFAEEGRRVYGDVLPPT 134 Query: 131 ATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTPLLTEKLVE 190 A D ++ PIGVV I P+NFP + A+ G T +LKP+E+TP L + Sbjct: 135 ANDRRQLVFKQPIGVVAAITPWNFPSAMFARKVGAALGAGCTMVLKPAEQTPFSALALAD 194 Query: 191 LFEKAGLPKGVFNVVYGAHDVVNG--ILEHPEIKAISFVGSKPVGEYVYKKGSENLKRVQ 248 L +AG+P GV NVV G + +P ++ +SF GS VG+ + ++ +EN+++ Sbjct: 195 LAMRAGVPAGVVNVVTARDPAPVGEELTGNPLVRKLSFTGSTEVGKILLRQAAENVQKCS 254 Query: 249 SLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEFMAKLQEKV 308 G IV DA+L+ V + + + G+ C++ + V E + EF A+L + Sbjct: 255 MELGGNAPLIVFADADLDLAVKGAIAVKYRNCGQTCISANRLLVHESVISEFAARLAARA 314 Query: 309 ADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDGRENVSDDGYFVGPTI 368 +++K+G+G D+GV LGP+I E ++ + L GA+L+ G + G F PT+ Sbjct: 315 SELKVGDGRDEGVALGPLIEEAAVEKCERQVADALARGAKLLLGGARH-KLGGSFFEPTV 373 Query: 369 FDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACLFTSNSNAIRYFREN 428 + VT + I+ +E F PV ++ + EA+ +AN + + A ++ + + I E Sbjct: 374 LEGVTADALIFNEETFGPVAPIVAFTDEAEALRLANATPYGLAAYFYSRDLSRIFRIAEA 433 Query: 429 IDAGMLGINLGVPAPMAFFPFSGWKSSFFGTLHANGKDSVDFYTRKKVV 477 +D GM+G+N + + A PF G K S G + VD Y K V Sbjct: 434 LDFGMIGVNETLMSSEA-APFGGMKQSGLG--REGSRYGVDDYLELKYV 479 Lambda K H 0.318 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 484 Length adjustment: 34 Effective length of query: 453 Effective length of database: 450 Effective search space: 203850 Effective search space used: 203850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory