Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_085773692.1 B1812_RS12475 D-glycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_002117405.1:WP_085773692.1 Length = 331 Score = 180 bits (457), Expect = 4e-50 Identities = 124/314 (39%), Positives = 170/314 (54%), Gaps = 12/314 (3%) Query: 4 IVAWKSLPEDVLAYLQQ--HAQVVQVDATQ-HDAFVAALKDADGGIGSSVKITPAML--E 58 +V + LPE + +++ A++ + D H+ A++ AD + + A L + Sbjct: 8 VVVTRRLPEVIETRMRELFDARLNENDKPPTHEELAEAMRTADVLVPTITDRIDASLIAQ 67 Query: 59 GATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELA 118 ++K ++ G D DVA RR I + NTP VLTE TAD +LILA ARR+VE A Sbjct: 68 AGEQMKLIANFGNGVDNIDVASALRRSITVTNTPGVLTEDTADMTMALILAVARRIVEGA 127 Query: 119 EWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANP- 177 + AG W + G + GK LGIVG+GRIG A+ARRA F + + Y NR P Sbjct: 128 NVIGAGSWGGWSPTWMLGRRITGKRLGIVGMGRIGQALARRAN-AFGLSIHYHNRRRLPA 186 Query: 178 QAEEAYGARRVE-LAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGAT 236 + EE A E L ++LA D + + P TP T HL+ A LK ++ AIL+N +RG Sbjct: 187 EIEEQLEATYWESLDQMLARVDILSIHCPHTPATYHLLSARRLKQLRPHAILVNTARGEI 246 Query: 237 VDEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLA---NVVALPHIGSATHETRHAM 293 VDE L+ L++ + GAGLDVFE EP S LLKLA V LPH+GSAT E R M Sbjct: 247 VDENELVRMLESDELAGAGLDVFEHEPAVSPK-LLKLAQAGKVTLLPHMGSATIEGRIDM 305 Query: 294 ARNAAENLVAALDG 307 N+ +DG Sbjct: 306 GEKVIVNIKTFIDG 319 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 331 Length adjustment: 28 Effective length of query: 293 Effective length of database: 303 Effective search space: 88779 Effective search space used: 88779 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory