Align Probable 2-dehydro-3-deoxy-D-pentonate aldolase YjhH; EC 4.1.2.28 (characterized)
to candidate WP_085772095.1 B1812_RS13730 4-hydroxy-tetrahydrodipicolinate synthase
Query= SwissProt::P39359 (301 letters) >NCBI__GCF_002117405.1:WP_085772095.1 Length = 325 Score = 102 bits (254), Expect = 1e-26 Identities = 71/212 (33%), Positives = 108/212 (50%), Gaps = 5/212 (2%) Query: 15 FHRDGTLDKKAMREVADFLINKGVDGLFYLGTGGEFSQMNTAQRMALAEEAVTIVDGRVP 74 F D + R VA + I++G GL G GE + ++ +R+ L E A R Sbjct: 50 FAEDDIAEDAFARYVA-WQIDEGCGGLVVGGAMGEGATLSRRERLRLIEIAAETASRRAV 108 Query: 75 VLIGVGSPSTDEAVKLAQHAQAYGADGIVAINPYYWKVAPRNLDDYYQQIARSVTLPVIL 134 V++ G+ T E+++ + AQ GA + PYY K R L ++Q+IAR+V LP+I+ Sbjct: 109 VIVATGTNCTRESIERTEAAQMAGASAALLATPYYNKPGQRGLLSHFQEIARAVDLPLII 168 Query: 135 YNFPDLTGQDLTPETVTRLALQNENIVGIKDTIDSVGHLRTMINTVKSVRPSFSVFCGYD 194 P T D+ PET+T+LA + NIV I + G L ++ S +P+ + CG D Sbjct: 169 EIDPARTAVDIGPETLTQLA-EIPNIVAI---AHADGGLASLRKRGPSAQPNSAHLCGSD 224 Query: 195 DHLLNTMLLGGDGAITASANFAPELSVGIYRA 226 D L GG G I+++AN P L + RA Sbjct: 225 DACAQFCLAGGSGWISSTANIVPALWSALQRA 256 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 325 Length adjustment: 27 Effective length of query: 274 Effective length of database: 298 Effective search space: 81652 Effective search space used: 81652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory