Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate WP_085771336.1 B1812_RS09250 SDR family NAD(P)-dependent oxidoreductase
Query= reanno::Korea:Ga0059261_1894 (259 letters) >NCBI__GCF_002117405.1:WP_085771336.1 Length = 241 Score = 105 bits (263), Expect = 7e-28 Identities = 85/240 (35%), Positives = 115/240 (47%), Gaps = 4/240 (1%) Query: 19 KRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAGAESQLLVERLSADGHKACFERVDLTD 78 + V+V+GG GIG I A+ G V IA ES+ L + F D D Sbjct: 2 RNVIVSGGSRGIGLAIGRRLAQDGYRV--IAIARRESEELRAEIQRLEGSLAFVPFDFND 59 Query: 79 VASLQAVIARLIKGAGGFDILVNNAANDDRHAIDEITEAYWDERLSVNLKHIFFCAQAVV 138 V + A++ RL K G LVNNAA A+ + A +E VN+ + V Sbjct: 60 VHEVPALVIRLKKEFGPPYGLVNNAALGTEGALGVMHNAQIEELTRVNMLAPILLTKYVA 119 Query: 139 PAMRARG-GGAIVNLGSISWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRDGIRATCVIP 197 + A G GG IVN+ SI G S L +Y KAA+ G T+SLAR++GR GI V P Sbjct: 120 RNIMAAGVGGRIVNIASIIASTGYSGLSVYGATKAAMVGFTKSLAREVGRTGITVNAVAP 179 Query: 198 GNVRTPRQLKWYSPEGEAEIVAAQCLDGRLAPEDVAAMVLFLASDDARLVTGHSYFVDAG 257 G + T + + +A+I L+ +DVA V FL SD A +TG + VDAG Sbjct: 180 GFIAT-EMTSMLNADEKAKIARRAALNRLAEVDDVANAVGFLFSDKASNITGTTITVDAG 238 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 241 Length adjustment: 24 Effective length of query: 235 Effective length of database: 217 Effective search space: 50995 Effective search space used: 50995 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory