Align ABC transporter related (characterized, see rationale)
to candidate WP_086510989.1 BZY95_RS16555 L-arabinose ABC transporter ATP-binding protein AraG
Query= uniprot:A0KWY5 (499 letters) >NCBI__GCF_002151265.1:WP_086510989.1 Length = 497 Score = 325 bits (834), Expect = 2e-93 Identities = 187/492 (38%), Positives = 293/492 (59%), Gaps = 9/492 (1%) Query: 5 LELKQISKHYPGVKALEDVSLRLFAGEVHALLGENGAGKSTLVKVMTGAQSKDMGDILFL 64 L IS +PGV+AL+ VS AG+VHAL+GENGAGKSTL+KV++G G + Sbjct: 6 LRFDGISMVFPGVRALDGVSFGAHAGQVHALMGENGAGKSTLLKVLSGVNHPSEGALWID 65 Query: 65 GEPQHFNTPMDAQKAGISTVYQEVNLVPNLTVAQNLFLGYEPRRLGLIHFKKMYADARAV 124 GE F +A GI+ +YQE+ L PN+TVA+NL LG P R G I +++ A A+ Sbjct: 66 GERHVFANAREALAQGIAIIYQELTLSPNMTVAENLLLGQLPTRHGFIKRRQLRERALAI 125 Query: 125 LTQF-KLDIDVSAPLSDYSIAVQQLIAIARGVAMSAKVLVLDEPTASLDAKEVQVLFGIL 183 L + DI S + + SI QQ+I I R + +A+++ DEPT+SL +E + L I+ Sbjct: 126 LADLGEGDIHPSTKVRELSIGQQQMIEIGRALLRNARIIAFDEPTSSLSVQETRQLKRII 185 Query: 184 NQLKAKGVAIVFITHFLDQVYQISDRITVLRNGQFIGEYLT-AELPQPKLIEAMLGRSLQ 242 ++L+ +G ++++TH +++V+ + D +TV R+G+ I + + A L L+ M+GR + Sbjct: 186 SRLREEGRVVLYVTHRMEEVFDMCDAVTVFRDGKHIRTHASLAALDHDTLVSEMVGRDI- 244 Query: 243 EQLVDKQEKERTVTRAEAVLLSLEDVSVKGSIQSMNLTVPKGQAVGLAGLLGSGRSEVCN 302 E + +E+ER V+L ++ + +G ++ V +G+ GL GL+G+GRSE+ Sbjct: 245 EDVYGYRERER-----GEVILEIDAIEGRGLKAPVSFEVRRGEVFGLFGLVGAGRSELMR 299 Query: 303 AVFGLDLVDSGSIHLAGQKLNLSQPVDAISAGIALCPEDRKIDGIIGPLSIRENIILALQ 362 V G + +G + GQ + P +AI GIA+CPEDRK GI S+ +N+ ++ + Sbjct: 300 LVCGAERASAGEVRFQGQARRFASPGEAIRMGIAMCPEDRKSQGIFPVASVADNLNISCR 359 Query: 363 ARIGWWRYLSNTRQQEI-AQFFIDKLQIATPDADKPIEQLSGGNQQKVILARWLAIEPIL 421 W L +TR++ A+ +I +L I TP I LSGGNQQKVILARWLA + L Sbjct: 360 RFFRRWGVLRDTRRERANAEAYIQRLSIKTPGPRTAIGTLSGGNQQKVILARWLAEKIEL 419 Query: 422 LVLDEPTRGIDIGAHAEIVKLIRTLCDEGMSLLVASSELDELVAFSNKVVVLRDRYAVRE 481 V+DEPTRGID+GA +I L+ L ++G S++V SS+L E+ + +++ V+RD V Sbjct: 420 FVVDEPTRGIDVGARRDIYTLLFDLTEQGKSVVVISSDLAEVSSICDRIGVMRDGALVEV 479 Query: 482 LSGAELTSQHVM 493 + E T + ++ Sbjct: 480 VPRHEATQERLL 491 Lambda K H 0.319 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 530 Number of extensions: 25 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 499 Length of database: 497 Length adjustment: 34 Effective length of query: 465 Effective length of database: 463 Effective search space: 215295 Effective search space used: 215295 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory