Align 2-dehydro-3-deoxy-L-arabinonate dehydratase (EC 4.2.1.43) (characterized)
to candidate WP_086510985.1 BZY95_RS16535 AraD1 family protein
Query= reanno::pseudo5_N2C3_1:AO356_24595 (330 letters) >NCBI__GCF_002151265.1:WP_086510985.1 Length = 328 Score = 389 bits (998), Expect = e-113 Identities = 197/314 (62%), Positives = 233/314 (74%), Gaps = 3/314 (0%) Query: 1 MRLVQFELSNGERRVGVVDGDQVREVQGAGSVRELALAAIEAGVKLEQQVDSLGLGTGHD 60 MRL+Q E G V+ D+V + A + LA A+ AG L V++ T D Sbjct: 1 MRLIQCE-HRGRVHAARVESDRVVRLLDADTYT-LARRALTAGQSLAAAVEAALTDTRLD 58 Query: 61 YARLLGELRILPPLDHPDPAHLLVSGTGLTHLGSASARDKMHQQAG-DEATMTDTMRIFK 119 Y +L+ + R+LPPL HPDPAH LV+GTGLTHLGSA RD MH +A D+A +TD+MR+FK Sbjct: 59 YPQLIEDKRLLPPLTHPDPAHCLVTGTGLTHLGSADTRDAMHAKAQVDDAALTDSMRMFK 118 Query: 120 WGVEGGKPQAGQTGVQPEWFYKGDGSIVVRPGHPFPLPPFAEDAGEEPEISGLYVIGHDG 179 GVEGGKP G+TG QPEWFYKGDGS VV P P+ FAEDAGEEPE++GLYVI DG Sbjct: 119 LGVEGGKPVPGETGAQPEWFYKGDGSCVVAPEAAIPVLHFAEDAGEEPELAGLYVIDDDG 178 Query: 180 KPYRLGFAVGNEFSDHVMERKNYLYLAHSKLRSCSFGPELRVGELPQHLSGTSRILRNGE 239 +P+R+G+A+GNEFSDHV ER NYL+LAHSKLR+CSFGPEL VGELP HL GTSR++R E Sbjct: 179 QPWRVGYALGNEFSDHVTERFNYLWLAHSKLRACSFGPELLVGELPTHLEGTSRVVRGNE 238 Query: 240 VLWQNEFLSGEANMCHSLENLEFHHFKYSQFLRPGDVHVHFFGTATLSFADGIRTQPGDV 299 +W+ FL+GEANM HSL NLE HHFKY F RPGDVHVHFFGTATLSFADGI+T+ GD Sbjct: 239 TVWEKPFLTGEANMAHSLANLEHHHFKYPNFRRPGDVHVHFFGTATLSFADGIQTRDGDR 298 Query: 300 FEISQAEFGAPLVN 313 FEIS EFG PL N Sbjct: 299 FEISLPEFGRPLRN 312 Lambda K H 0.319 0.139 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 328 Length adjustment: 28 Effective length of query: 302 Effective length of database: 300 Effective search space: 90600 Effective search space used: 90600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory