Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_086508348.1 BZY95_RS02060 ATP-binding cassette domain-containing protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_002151265.1:WP_086508348.1 Length = 256 Score = 223 bits (568), Expect = 3e-63 Identities = 116/248 (46%), Positives = 165/248 (66%), Gaps = 10/248 (4%) Query: 21 IAIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKII 80 I +++ + K +G VL+ ++L +G+ I + G SGSGKST +RC+N LE+ G +I Sbjct: 6 IPLEVRNIKKRFGDTEVLKGLSLEARKGDVITLIGASGSGKSTFLRCMNLLEQPDEGDLI 65 Query: 81 VDGIELT----------SDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVP 130 V G E+ +D K + ++R+++ MVFQ FNL+ H+T+LEN+ API V P Sbjct: 66 VHGEEIRFKHTKHGREPADWKQVVRMRAKLSMVFQSFNLWSHMTLLENVIEAPIHVLGKP 125 Query: 131 KREAEETAMYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDP 190 K+EA E A L++V + +A YP Q+SGGQQQR AIAR+L M P++MLFDEPTSALDP Sbjct: 126 KKEAIEHARALLDRVGLTARADAYPAQMSGGQQQRGAIARALAMDPEVMLFDEPTSALDP 185 Query: 191 EMIKEVLDTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQS 250 E++ +VL M LAEEG TM+ VTHEMGFA+ V+++VI++ G + E P + NP S Sbjct: 186 ELVGDVLKVMRDLAEEGRTMVVVTHEMGFARDVSSQVIYLHQGLVEEAGPPQEVLVNPTS 245 Query: 251 ERTKQFLS 258 R KQFL+ Sbjct: 246 PRLKQFLA 253 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 256 Length adjustment: 24 Effective length of query: 239 Effective length of database: 232 Effective search space: 55448 Effective search space used: 55448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory