Align PP1069, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate WP_086508439.1 BZY95_RS02560 amino acid ABC transporter permease
Query= TCDB::Q88NY4 (223 letters) >NCBI__GCF_002151265.1:WP_086508439.1 Length = 217 Score = 117 bits (294), Expect = 1e-31 Identities = 70/216 (32%), Positives = 114/216 (52%), Gaps = 10/216 (4%) Query: 7 EIIPALPALWEGMVMTLKLMVMGVIGGIVLGTILALMRLSSSKLLSNLAGAYVNYFRSIP 66 ++I PA MTL++ + + +V+G I ALM++S + L + YV R P Sbjct: 7 DLIATFPAFTRAAWMTLQITGISLGLALVIGLIFALMKVSGLRSLGIVYNGYVGIIRGTP 66 Query: 67 LLLVITWFYLAVP-FVLRWITGEDTPVGAFTSCVVAFMMFEAAYFCEIVRAGVQSISKGQ 125 L++ I W Y + FV+ + AF + +A + AY EI R +QS+ +GQ Sbjct: 67 LIVQIMWLYFGITHFVV---------LSAFWAGTIALAIHSGAYIAEIFRGCIQSVDRGQ 117 Query: 126 MGAAQALGMNYAQTMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYTVGLVDFLNSARSN 185 M AAQ+LGM MR IILPQAF++ P + Q II +D+SLV +G+ + + + N Sbjct: 118 MEAAQSLGMKRGLAMRRIILPQAFKRAIPPMGNQFIIGLKDSSLVAFIGITEIFSLSMDN 177 Query: 186 GDIIGRSHEFLIFAGVVYFLISFSASWLVKRLQKRI 221 + + EF AG+ Y + ++++ RL+ R+ Sbjct: 178 AAVTFKQLEFYTIAGLYYLAMVALFTYVLSRLEHRM 213 Lambda K H 0.330 0.141 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 217 Length adjustment: 22 Effective length of query: 201 Effective length of database: 195 Effective search space: 39195 Effective search space used: 39195 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory