Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_086508348.1 BZY95_RS02060 ATP-binding cassette domain-containing protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_002151265.1:WP_086508348.1 Length = 256 Score = 203 bits (516), Expect = 3e-57 Identities = 108/246 (43%), Positives = 159/246 (64%), Gaps = 12/246 (4%) Query: 2 IELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVVN 61 +E++N+ K +G VLK ++L ++G+ + +IG SGSGKST +RCMN LE+ G+++V+ Sbjct: 8 LEVRNIKKRFGDTEVLKGLSLEARKGDVITLIGASGSGKSTFLRCMNLLEQPDEGDLIVH 67 Query: 62 NLVLNHKN-----------KIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKK 110 + K+ ++ R +MVFQ FNL+ HMT+L+N+ AP+ + K KK Sbjct: 68 GEEIRFKHTKHGREPADWKQVVRMRAKLSMVFQSFNLWSHMTLLENVIEAPIHVLGKPKK 127 Query: 111 EAEETAFKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPET 170 EA E A L VGL +A+ YPA +SGGQQQR AIAR+L +LFDEPTSALDPE Sbjct: 128 EAIEHARALLDRVGLTARADAYPAQMSGGQQQRGAIARALAMDPEVMLFDEPTSALDPEL 187 Query: 171 IQEVLDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTE 230 + +VL VM++++ + TMVVVTHEMGFA++V+ ++I++ G + E P E NP + Sbjct: 188 VGDVLKVMRDLAEEGR-TMVVVTHEMGFARDVSSQVIYLHQGLVEEAGPPQEVLVNPTSP 246 Query: 231 RARLFL 236 R + FL Sbjct: 247 RLKQFL 252 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 256 Length adjustment: 24 Effective length of query: 218 Effective length of database: 232 Effective search space: 50576 Effective search space used: 50576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory