Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_086509933.1 BZY95_RS10800 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_002151265.1:WP_086509933.1 Length = 255 Score = 158 bits (399), Expect = 1e-43 Identities = 85/229 (37%), Positives = 131/229 (57%), Gaps = 3/229 (1%) Query: 21 VSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNPINMLSSRQLARRLSL 80 ++LS+ G++ ++GPNG GK+TLL+ + L P++G V + P+ L RQ+AR+L L Sbjct: 22 LTLSVEPGQVWGVLGPNGAGKTTLLHTLAGLRGPRAGQVLIDGRPLAALGRRQVARKLGL 81 Query: 81 LPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTRINHLAVRRLTELS 140 + Q TV+E GR+PWLS W ED A+ + ++HLA R ++ LS Sbjct: 82 VFQERHDGFPATVRETALIGRHPWLSAWQMEGGEDLRLAEAALERLDVDHLAERLVSTLS 141 Query: 141 GGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMGELRTQGKTVVAVLHDLNQ 200 GG+RQR +A VL Q + L DEPT +LD++HQ +M L+ E +G+ V+ LHDLN Sbjct: 142 GGERQRLAIATVLTQAPQIWLADEPTNHLDLHHQSAVMALLAEQAAEGRAVMMCLHDLNL 201 Query: 201 ASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFS---VEAEIHPEPV 246 A+R+CD L+++ G +++ P L ++ AEI PV Sbjct: 202 AARWCDHLLLLYPDGEACWGPARDMLVPAALERLYGQRLATAEIDGAPV 250 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 255 Length adjustment: 24 Effective length of query: 231 Effective length of database: 231 Effective search space: 53361 Effective search space used: 53361 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory