Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_086510236.1 BZY95_RS12370 ATP-binding cassette domain-containing protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_002151265.1:WP_086510236.1 Length = 255 Score = 175 bits (444), Expect = 7e-49 Identities = 90/231 (38%), Positives = 140/231 (60%), Gaps = 1/231 (0%) Query: 16 KVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNPINMLSSRQLA 75 ++L VS + GK+ LIG NG GKSTL+ ++ G + L P+ R+ A Sbjct: 15 RLLQPVSHAFSEGKVYGLIGHNGSGKSTLIKLLAQQQPASRGKILLDGKPLEDWGQREFA 74 Query: 76 RRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTRINHLAVRR 135 RR++ LPQH + E + +EL+ +GR PW L GR + +D A + A+ + A R Sbjct: 75 RRVAYLPQHLPSAENLIGRELIGFGRYPWHGLLGRQTPKDKAAIERAIELSHTEAFADRL 134 Query: 136 LTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMGELRTQGK-TVVAV 194 + LSGG+RQR +LAM+LAQ + +LLDEP LDI HQ++++ L+ +L + + V+ V Sbjct: 135 VDTLSGGERQRVWLAMLLAQESRFLLLDEPLAALDIAHQMEVLSLIRKLCDELRLCVIIV 194 Query: 195 LHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEIHPEP 245 LHD+N ASRYCD+L+ + +G V+A G+PE +MT L ++ + ++ P P Sbjct: 195 LHDINMASRYCDELLALHSGRVLAHGSPERIMTGSTLEAIYGLPMQVMPHP 245 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 255 Length adjustment: 24 Effective length of query: 231 Effective length of database: 231 Effective search space: 53361 Effective search space used: 53361 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory