Align ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale)
to candidate WP_086508344.1 BZY95_RS02040 transporter substrate-binding domain-containing protein
Query= uniprot:A0A1N7UK26 (258 letters) >NCBI__GCF_002151265.1:WP_086508344.1 Length = 261 Score = 164 bits (416), Expect = 1e-45 Identities = 101/256 (39%), Positives = 142/256 (55%), Gaps = 7/256 (2%) Query: 1 MTPLRSLFAALLLP--LCATAHAQEWKEIRFGVFPEYPPFESVAADGSLQGFDIELGNAI 58 M L + AA L TA A+++ EIR GV Y PF DG L GF+IELGNA+ Sbjct: 1 MRALNMILAATLAAGLTAGTAQARDYSEIRLGVDIPYEPFMYRQPDGELTGFEIELGNAV 60 Query: 59 CAKLEVKCTWVHNEFDGMIPALRARKFDAIMSSMAVTPAREKIIDFSDRLFLSPTSVITR 118 C LEV CTWV ++DG+IP L AR +DAIMSSMA+T R + + FS+ + +P++ IT Sbjct: 61 CEYLEVTCTWVEQDWDGIIPGLMARNYDAIMSSMAITEERAERVLFSEPYYTTPSAWITT 120 Query: 119 KSADFG-DTPESLMGKQVGVLQGSLQEAYARAHLAKLGAQIKAYQSQDQNYADLQNGRLD 177 + D + +SL G VGV + +LQ+ Y L +I+ Y S D D++ GRLD Sbjct: 121 RDRDIDIEDRDSLAGLVVGVQRATLQDNYVSELYGDL-VEIRRYTSADDVVTDMRAGRLD 179 Query: 178 ATLTDKLEAQLNFLSKPEGSDFKTGPAF-KDP--TLPLDIAMGLRKNDQALRALINKGIA 234 T D A+ GS FK F K+P + + R+ D+AL N+ +A Sbjct: 180 LTFMDYPVAENTMGIDTSGSHFKRISGFIKEPEHIFGKGVGVAFRQRDEALAERFNEALA 239 Query: 235 AVQADGTYAQIQKKYF 250 A++ DGTY +I ++YF Sbjct: 240 ALKEDGTYDEIMERYF 255 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 261 Length adjustment: 24 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory