Align Histidine transport system permease protein HisQ (characterized)
to candidate WP_086508346.1 BZY95_RS02050 ABC transporter permease
Query= SwissProt::P52094 (228 letters) >NCBI__GCF_002151265.1:WP_086508346.1 Length = 243 Score = 102 bits (254), Expect = 7e-27 Identities = 69/223 (30%), Positives = 108/223 (48%), Gaps = 12/223 (5%) Query: 7 GVILQGALVTLELAISSVVLAVIIGLIGAGGKLSQNRLSGLIFEGYTTLIRGVPDLVLML 66 G G ++T +L S+V +++ + A G+ S R L YT + RG P L+ + Sbjct: 23 GYYWDGLVLTTQLVFLSLVAGLVLAIPLAIGRSSGRRWISLPIYVYTYVFRGTPLLIQLY 82 Query: 67 LIFYGLQIALNTVTEAMGVGQIDIDPMVA-----GIITLGFIYGAYFTETFRGAFMAVPK 121 +I+YG V G+ Q + P++ +I AY TE FRGA A P+ Sbjct: 83 IIYYG-------VVFFDGIQQTFLWPILREAFYPALIAFTLNTAAYTTEIFRGAIKATPR 135 Query: 122 GHIEAATAFGFTRGQVFRRIMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKATQ 181 G IEAA A+G ++G + RRI+ PS R ALP GN +L ++A+ S++ L D+ A + Sbjct: 136 GEIEAARAYGMSQGLMMRRIVLPSAFRRALPAYGNEVIFMLHASAIASVVTLMDITGAAR 195 Query: 182 LAGKSTWEPFYFAIVCGVIYLVFTTVSNGVLLFLERRYSVGVK 224 + PF + IYL T +LE++ +K Sbjct: 196 FVYARFYAPFEAFLFAAAIYLCLTFAILYFFRYLEKKLLAHLK 238 Lambda K H 0.328 0.145 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 243 Length adjustment: 23 Effective length of query: 205 Effective length of database: 220 Effective search space: 45100 Effective search space used: 45100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory