Align D-lysine oxidase (EC 1.4.3.3) (characterized)
to candidate WP_086511190.1 BZY95_RS17555 FAD-dependent oxidoreductase
Query= metacyc::G1G01-3833-MONOMER (414 letters) >NCBI__GCF_002151265.1:WP_086511190.1 Length = 413 Score = 380 bits (976), Expect = e-110 Identities = 192/409 (46%), Positives = 247/409 (60%), Gaps = 2/409 (0%) Query: 6 LVLGAGIVGVSTALHLQARGRQVILIDRDEPGSGTSHGNAGLIERSSVIPYAFPRQLSAL 65 +VLGAG+VGVS A HL RG V L+DR EPG TS GNAG+I+R +V PYAFPR ++ L Sbjct: 6 IVLGAGMVGVSVAWHLVRRGHDVTLVDRREPGLETSFGNAGIIQREAVRPYAFPRDVATL 65 Query: 66 LRYGLNRQPDVRYSLAHLPKAAPWLWRYWRQSAPGRLAGAAADMLPLVQRCVDEHDALIA 125 LR NRQ D+RY + AA L YW S+ R + L+ RC D H +I Sbjct: 66 LRVVPNRQVDIRYRPTGMLSAAGPLMNYWLNSSGKRYERIVTEWASLIMRCQDAHAPMIE 125 Query: 126 AAGLEGLVQAKGWIEVFRDPALFEQAKTDAK-GLSRYGLRFEILECGQLQAREHQLDATV 184 AAG E LV+ GW+E++R FE+ + +A+ R+G+ +E L+ L A+E L + Sbjct: 126 AAGAEALVRKGGWLELYRTQKEFEERQKEAQENHERFGVEYEALDAEALYAKEPHLAKGL 185 Query: 185 VGGIHWLDPKTVNNPGALTRGYAALFLQRGGQFVHGDARSLRQANGQWRVESRRGPITAD 244 VG IHW P V++PG L + YA F +GGQ + Q G WRV + GP+ A+ Sbjct: 186 VGAIHWTQPWMVSDPGGLVQAYARSFAAQGGQVKQASVEDVLQVEGGWRVNTSEGPMEAE 245 Query: 245 EVVACLGPQSADLFSGLGYQIPLAIKRGYHMHYSTRDGAQLEHSICDTQGGYVLAPMARG 304 +VV LGP + +L LG ++PL +KRGYHMHYS A+L H + D + G++L PM G Sbjct: 246 QVVVALGPWAGELLGRLGIKVPLFVKRGYHMHYSAEGDAKLNHWVMDAEKGFLLEPMRAG 305 Query: 305 VRLTTGIEFDAASAPGNQIQLGRCEALARKLFPALGDRLDDTPWLGRRPCLPDMRPVIGP 364 +RLTTG E +P QL E +ARKLFP LG R D PW G RPCLPDM+PVIGP Sbjct: 306 IRLTTGAELADLDSPPQYKQLAAAEKVARKLFP-LGKRRDSQPWKGARPCLPDMKPVIGP 364 Query: 365 APRHPGLWFNFGHAHHGLTLGPVCGRLLAELLTGEPPFTDPAPYSATRF 413 AP GLW FGH H G TLGP G LLA+++ GE P D AP+ RF Sbjct: 365 APNKEGLWLAFGHGHQGFTLGPATGELLAQMMDGEEPAVDMAPFRVDRF 413 Lambda K H 0.322 0.140 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 542 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 414 Length of database: 413 Length adjustment: 31 Effective length of query: 383 Effective length of database: 382 Effective search space: 146306 Effective search space used: 146306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory