Align Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase; Ch1CoA; EC 1.3.8.10 (characterized)
to candidate WP_086510406.1 BZY95_RS13300 isovaleryl-CoA dehydrogenase
Query= SwissProt::Q2LQN9 (414 letters) >NCBI__GCF_002151265.1:WP_086510406.1 Length = 389 Score = 272 bits (696), Expect = 1e-77 Identities = 154/382 (40%), Positives = 223/382 (58%), Gaps = 17/382 (4%) Query: 37 LTEEQKLLMEMVRNLAVREIAPRAIEIDENHSFPVHARDLFADLGLLSPLVPVEYGGTGM 96 L +E +L + V A EIAPRA EIDE + FP F D+GLL VP E GGTGM Sbjct: 12 LDDELNMLRDQVNAFARDEIAPRAAEIDEKNEFPNDLWQKFGDMGLLGITVPEEDGGTGM 71 Query: 97 DITTFAMVLEEIGKVCASTALMLLAQADGMLSII-LDGSPALKEKYLPRF--GEKSTLMT 153 + +EEI + AS L A ++ ++ + ++ + K KYLP+ GE + Sbjct: 72 GYLAHCIAMEEISRASASVGLSYGAHSNLCVNQLKINANAEQKAKYLPKLISGEH---IG 128 Query: 154 AFAATEPGAGSDLLAMKTRAVKKGDKYVINGQKCFITNGSVADILTVWAYTDPSKGAKGM 213 A A +EPGAGSD+++MK RA ++GDKY++NG K +ITNG AD+L V+A TDP G+KG+ Sbjct: 129 ALAMSEPGAGSDVVSMKLRARQEGDKYILNGNKMWITNGPDADVLVVYAKTDPEAGSKGI 188 Query: 214 STFVVERGTPGLIYGHNEKKMGMRGCPNSELFFEDLEVPAENLVGEEGKGFAYLMGALSI 273 + F++E+G PG K+GMRG EL F+D EVP EN++G+EGKG LM L Sbjct: 189 TAFIIEKGMPGFSTAQKLDKLGMRGSNTCELVFQDCEVPVENVLGDEGKGVRVLMSGLDY 248 Query: 274 NRVFCASQAVGIAQGALERAMQHTREREQFGKPIAHLTPIQFMIADMATEVEAARLLVRK 333 R A+ +GI Q A++ + + ER+QF + I +Q IADM T + A R + Sbjct: 249 ERTVLAAGPIGIMQAAMDVVVPYVHERKQFNQSIGEFQLVQGKIADMYTTLNACRAYLYA 308 Query: 334 ATTLLD-----AKDKRGPLIGGMAKTFASDTAMKVTTDAVQVMGGSGYMQEYQVERMMRE 388 D KD G ++ + ++ A +V DA+Q++GG+GY+ EY R++R+ Sbjct: 309 VAAACDRGQTSRKDAAGVIL------YCAEKATQVALDAIQLLGGNGYINEYPTGRLLRD 362 Query: 389 AKLTQIYTGTNQITRMVTGRSL 410 AKL +I GT++I RM+ GR L Sbjct: 363 AKLYEIGAGTSEIRRMLIGREL 384 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 414 Length of database: 389 Length adjustment: 31 Effective length of query: 383 Effective length of database: 358 Effective search space: 137114 Effective search space used: 137114 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory