Align RhaT, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate WP_086510989.1 BZY95_RS16555 L-arabinose ABC transporter ATP-binding protein AraG
Query= TCDB::Q7BSH4 (512 letters) >NCBI__GCF_002151265.1:WP_086510989.1 Length = 497 Score = 345 bits (884), Expect = 3e-99 Identities = 187/490 (38%), Positives = 294/490 (60%), Gaps = 3/490 (0%) Query: 21 LEMRGISQIFPGVKALDNVSIALHPGTVTALIGENGAGKSTLVKILTGIYRPNEGEILVD 80 L GIS +FPGV+ALD VS H G V AL+GENGAGKSTL+K+L+G+ P+EG + +D Sbjct: 6 LRFDGISMVFPGVRALDGVSFGAHAGQVHALMGENGAGKSTLLKVLSGVNHPSEGALWID 65 Query: 81 GRPTTFASAQAAIDAGVTAIHQETVLFDELTVAENIFLGHAPRTRFRTIDWQTMNSRSKA 140 G FA+A+ A+ G+ I+QE L +TVAEN+ LG P TR I + + R+ A Sbjct: 66 GERHVFANAREALAQGIAIIYQELTLSPNMTVAENLLLGQLP-TRHGFIKRRQLRERALA 124 Query: 141 LLTAL-ESNIDPTIRLKDLSIAQRHLVAIARALSIEARIVIMDEPTAALSRKEIDDLFRI 199 +L L E +I P+ ++++LSI Q+ ++ I RAL ARI+ DEPT++LS +E L RI Sbjct: 125 ILADLGEGDIHPSTKVRELSIGQQQMIEIGRALLRNARIIAFDEPTSSLSVQETRQLKRI 184 Query: 200 VRGLKEQGKAILFISHKFDELYEIADDFVVFPRRSRRPVRGVSRKTPQDEIVRMMVGRDV 259 + L+E+G+ +L+++H+ +E++++ D VF D +V MVGRD+ Sbjct: 185 ISRLREEGRVVLYVTHRMEEVFDMCDAVTVFRDGKHIRTHASLAALDHDTLVSEMVGRDI 244 Query: 260 ENVFPKIDVAIGGPVLEIRNYSHRTEFRDISFTLRKGEILGVYGLIGAGRSELSQSLFGI 319 E+V+ + G +LEI R +SF +R+GE+ G++GL+GAGRSEL + + G Sbjct: 245 EDVYGYRERERGEVILEIDAIEGRGLKAPVSFEVRRGEVFGLFGLVGAGRSELMRLVCGA 304 Query: 320 TKPLSGKMVLEGQEITIHSPQDAIRAGIVYVPEERGRHGLALPMPIFQNMTLPSLARTSR 379 + +G++ +GQ SP +AIR GI PE+R G+ + N+ + R Sbjct: 305 ERASAGEVRFQGQARRFASPGEAIRMGIAMCPEDRKSQGIFPVASVADNLNISCRRFFRR 364 Query: 380 RGFLR-AANEFALARKYAERLDLRAAALSVPVGTLSGGNQQKVVIGKWLATAPKVIILDE 438 G LR E A A Y +RL ++ +GTLSGGNQQKV++ +WLA ++ ++DE Sbjct: 365 WGVLRDTRRERANAEAYIQRLSIKTPGPRTAIGTLSGGNQQKVILARWLAEKIELFVVDE 424 Query: 439 PTKGIDIGSKAAVHGFISELAAEGLSIIMVSSELPEIIGMSDRVLVMKEGLSAGIFERAE 498 PT+GID+G++ ++ + +L +G S++++SS+L E+ + DR+ VM++G + R E Sbjct: 425 PTRGIDVGARRDIYTLLFDLTEQGKSVVVISSDLAEVSSICDRIGVMRDGALVEVVPRHE 484 Query: 499 LSPEALVRAA 508 + E L+ A Sbjct: 485 ATQERLLGLA 494 Lambda K H 0.320 0.137 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 596 Number of extensions: 32 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 512 Length of database: 497 Length adjustment: 34 Effective length of query: 478 Effective length of database: 463 Effective search space: 221314 Effective search space used: 221314 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory