Align ABC transporter (characterized, see rationale)
to candidate WP_086511129.1 BZY95_RS17245 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:A0A166QFW2 (381 letters) >NCBI__GCF_002151265.1:WP_086511129.1 Length = 380 Score = 357 bits (917), Expect = e-103 Identities = 198/367 (53%), Positives = 252/367 (68%), Gaps = 7/367 (1%) Query: 1 MIKLKLDNVNKQLGGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDL 60 M L+L ++ K+ +++ V LE+ EFVVFVGPSGCGKSTLLR+IAGL+S GD+ Sbjct: 1 MATLQLHDIVKRFDDTEVIKGVDLEVNDREFVVFVGPSGCGKSTLLRMIAGLESATSGDI 60 Query: 61 LIDGRRVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQI 120 LIDG R+N++ P ERG+ MVFQSYALYPHM+V DN+ F LKLA K R +V + A I Sbjct: 61 LIDGVRMNEVGPAERGLAMVFQSYALYPHMTVEDNMGFSLKLAGVPKEERRRKVREAASI 120 Query: 121 LQLDKLLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLH 180 LQL+ LL+RKPK LSGGQRQRVA+GRA+ R P I LFDEPLSNLDA+LRVQMR E+ARLH Sbjct: 121 LQLEPLLERKPKALSGGQRQRVAIGRAIVRNPSIFLFDEPLSNLDAALRVQMRIELARLH 180 Query: 181 DRLGSTMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGSPRMN 240 + L +TMIYVTHDQ+EAMT+ADKIVVL GG VEQVGSP ELY P +RFVAGF+GSP+MN Sbjct: 181 EELDATMIYVTHDQIEAMTMADKIVVLQGGVVEQVGSPMELYHHPRNRFVAGFIGSPKMN 240 Query: 241 FLSARLQTPGETSLVDTLVWGIT-SLPFDSSNLAAGTPLSLGIRPEHVSLKAADGTAGVV 299 FL + T + L G T ++P D S L L+LGIRPEH+ L +G Sbjct: 241 FLEVERVSAAATGVEVRLPDGDTCTVPVDGSGL-DDDALTLGIRPEHLQLDPQGPLSG-R 298 Query: 300 VTAVEYLGSETYVHLETGQDEPLICRCEVSAGWQAGDRVELLLDLDNLHLFDADGVA--- 356 + +E LG T +++ Q+ + + + + GD + + D HLFD +G+A Sbjct: 299 IEVIERLGGVTSLYVRM-QNTLVTVSADGNVDSRVGDSLRFGFERDCAHLFDGEGLALPS 357 Query: 357 LSRHPHA 363 L+RHP A Sbjct: 358 LARHPLA 364 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 380 Length adjustment: 30 Effective length of query: 351 Effective length of database: 350 Effective search space: 122850 Effective search space used: 122850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory