Align TreV, component of Trehalose porter (characterized)
to candidate WP_086511129.1 BZY95_RS17245 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q97ZC0 (324 letters) >NCBI__GCF_002151265.1:WP_086511129.1 Length = 380 Score = 253 bits (646), Expect = 5e-72 Identities = 142/336 (42%), Positives = 202/336 (60%), Gaps = 29/336 (8%) Query: 2 TVELIDIVKKYGKNIVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKIIA 61 T++L DIVK++ VI G+ ++ EF V +GPSG GKSTLL+++AG+E G I+ Sbjct: 3 TLQLHDIVKRFDDTEVIKGVDLEVNDREFVVFVGPSGCGKSTLLRMIAGLESATSGDILI 62 Query: 62 DGADITDKPPEKRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAKLLG 121 DG + + P +R +AMVFQ+YALYP+M+V DN+ F LK+ G+ KEE +V +AA +L Sbjct: 63 DGVRMNEVGPAERGLAMVFQSYALYPHMTVEDNMGFSLKLAGVPKEERRRKVREAASILQ 122 Query: 122 ISEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRIQKE 181 + +L++K +SGGQ+QRVA+ RAIVRNPS FL DEPLSNLDA +R R EL R+ +E Sbjct: 123 LEPLLERKPKALSGGQRQRVAIGRAIVRNPSIFLFDEPLSNLDAALRVQMRIELARLHEE 182 Query: 182 LKGTFIYVTHDQKEALSLADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFVGEFPMNFL 241 L T IYVTHDQ EA+++AD+I +L G EQV P LY +P+ ++VA F+G MNFL Sbjct: 183 LDATMIYVTHDQIEAMTMADKIVVLQGGVVEQVGSPMELYHHPRNRFVAGFIGSPKMNFL 242 Query: 242 --------------------------PGELMKEKAQEIGFRPEWVEVG-KGNLSCMVESV 274 G + + A +G RPE +++ +G LS +E + Sbjct: 243 EVERVSAAATGVEVRLPDGDTCTVPVDGSGLDDDALTLGIRPEHLQLDPQGPLSGRIEVI 302 Query: 275 EASGESRYLICNFKNNNITILSQEFYD--VGQEVRF 308 E G L +N +T+ + D VG +RF Sbjct: 303 ERLGGVTSLYVRMQNTLVTVSADGNVDSRVGDSLRF 338 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 380 Length adjustment: 29 Effective length of query: 295 Effective length of database: 351 Effective search space: 103545 Effective search space used: 103545 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory