Align D-ribose transporter ATP-binding protein; SubName: Full=Putative xylitol transport system ATP-binding protein; SubName: Full=Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_086510989.1 BZY95_RS16555 L-arabinose ABC transporter ATP-binding protein AraG
Query= uniprot:A0A1N7TX47 (495 letters) >NCBI__GCF_002151265.1:WP_086510989.1 Length = 497 Score = 308 bits (788), Expect = 4e-88 Identities = 176/490 (35%), Positives = 275/490 (56%), Gaps = 3/490 (0%) Query: 7 LQAEHVAKAYAGVPALRDGRLSLRAGSVHALCGGNGAGKSTFLSILMGITQRDAGSILLN 66 L+ + ++ + GV AL AG VHAL G NGAGKST L +L G+ G++ ++ Sbjct: 6 LRFDGISMVFPGVRALDGVSFGAHAGQVHALMGENGAGKSTLLKVLSGVNHPSEGALWID 65 Query: 67 GAPVQFNRPSEALAAGIAMITQELEPIPYMTVAENIWLGREPRRAGCIVDNKALNRRTRE 126 G F EALA GIA+I QEL P MTVAEN+ LG+ P R G I + R Sbjct: 66 GERHVFANAREALAQGIAIIYQELTLSPNMTVAENLLLGQLPTRHGFIKRRQLRERALAI 125 Query: 127 LLDSLEFDVDATSPMHRLSVAQIQLVEIAKAFSHDCQVMIMDEPTSAIGEHEAQTLFKAI 186 L D E D+ ++ + LS+ Q Q++EI +A + +++ DEPTS++ E + L + I Sbjct: 126 LADLGEGDIHPSTKVRELSIGQQQMIEIGRALLRNARIIAFDEPTSSLSVQETRQLKRII 185 Query: 187 RRLTAQGAGIVYVSHRLSELAQIADDYSIFRDGAFVES-GRMADIDRDHLVRGIVGQELT 245 RL +G ++YV+HR+ E+ + D ++FRDG + + +A +D D LV +VG+++ Sbjct: 186 SRLREEGRVVLYVTHRMEEVFDMCDAVTVFRDGKHIRTHASLAALDHDTLVSEMVGRDIE 245 Query: 246 RIDHKVGRECAANTCLQVDNLSRAGEFHDISLQLRQGEILGIYGLMGSGRSEFLNCIYGL 305 + RE L++D + G +S ++R+GE+ G++GL+G+GRSE + + G Sbjct: 246 DVYGYRERE-RGEVILEIDAIEGRGLKAPVSFEVRRGEVFGLFGLVGAGRSELMRLVCGA 304 Query: 306 TVADSGSVTLQGKPMPIGLPKATINAGMSLVTEDRKDSGLVLTGSILSNIALSAYKRLSS 365 A +G V QG+ P I G+++ EDRK G+ S+ N+ +S + Sbjct: 305 ERASAGEVRFQGQARRFASPGEAIRMGIAMCPEDRKSQGIFPVASVADNLNISCRRFFRR 364 Query: 366 WSLI-NARKETQLAEDMVKRLQIKTTSLELPVASMSGGNQQKVVLAKCLSTEPVCLLCDE 424 W ++ + R+E AE ++RL IKT + ++SGGNQQKV+LA+ L+ + + DE Sbjct: 365 WGVLRDTRRERANAEAYIQRLSIKTPGPRTAIGTLSGGNQQKVILARWLAEKIELFVVDE 424 Query: 425 PTRGIDEGAKQEIYHLLDQFVRGGGAAIVVSSEAPELLHLSDRIAVFKGGRLVTISTDTA 484 PTRGID GA+++IY LL G + +V+SS+ E+ + DRI V + G LV + Sbjct: 425 PTRGIDVGARRDIYTLLFDLTEQGKSVVVISSDLAEVSSICDRIGVMRDGALVEVVPRHE 484 Query: 485 LSQEALLRLA 494 +QE LL LA Sbjct: 485 ATQERLLGLA 494 Lambda K H 0.319 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 525 Number of extensions: 22 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 497 Length adjustment: 34 Effective length of query: 461 Effective length of database: 463 Effective search space: 213443 Effective search space used: 213443 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory