Align Glyceraldehyde dehydrogenase small chain; Glyceraldehyde dehydrogenase subunit C; Glyceraldehyde dehydrogenase subunit gamma; EC 1.2.99.8 (characterized)
to candidate WP_086511204.1 BZY95_RS17660 (2Fe-2S)-binding protein
Query= SwissProt::Q4J6M5 (163 letters) >NCBI__GCF_002151265.1:WP_086511204.1 Length = 149 Score = 122 bits (307), Expect = 2e-33 Identities = 61/144 (42%), Positives = 88/144 (61%), Gaps = 1/144 (0%) Query: 16 VNGVWYEKYVSPRTLLVDFIRDELGLTGTKVGCDTTTCGACTVIMNGKSVKSCTVLAAQA 75 +NG +P T L+ IR+EL LTGTK GC CGACTV ++G+ V++C A A Sbjct: 6 INGRSVVVTATPDTPLLWVIREELKLTGTKYGCGVAQCGACTVHVDGEPVRACVFSLAGA 65 Query: 76 DGAEITTIEGLSSDSKLHPIQEAFKDNFALQCGFCTAGMIMQTYFFLKEHPNPTEEEVRD 135 +G +TTIEGLS D HP+Q A+ + QCG+C +G IM L +P+PT+E++ + Sbjct: 66 EGRSVTTIEGLSDDGS-HPVQRAWVELEVPQCGYCQSGQIMSAAALLAHNPSPTDEQIDE 124 Query: 136 GIHGNICRCTGYQNIVKAVLDASK 159 + GN+CRC Y I A+ A++ Sbjct: 125 VMRGNLCRCGTYSRIRAAIHHATE 148 Lambda K H 0.321 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 94 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 149 Length adjustment: 17 Effective length of query: 146 Effective length of database: 132 Effective search space: 19272 Effective search space used: 19272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory