Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_234244490.1 BZY95_RS20650 ABC transporter ATP-binding protein
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_002151265.1:WP_234244490.1 Length = 398 Score = 286 bits (731), Expect = 9e-82 Identities = 169/364 (46%), Positives = 227/364 (62%), Gaps = 20/364 (5%) Query: 4 LELRNVNKTYGAGLPDT--LKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGGA 61 + L V+K +G DT + I + GEF+IL+GPSGCGKST + IAGLE T G Sbjct: 7 IRLEAVSKRWG----DTAAVDAIGFDVAPGEFVILLGPSGCGKSTTLRMIAGLEQATAGR 62 Query: 62 IMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVAK 121 I IG +DV+ + P DR I+MVFQSYAL+P +SV +NI FGL+ RK+P+A+ +ARVA+ Sbjct: 63 IEIGGRDVTHLPPGDRGISMVFQSYALFPHLSVADNIVFGLRSRKVPKAERRERLARVAQ 122 Query: 122 LLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLM 181 L+ +E L RKP QLSGGQ+QRVA+ RA+ I L DEPLSNLDA+LR EMR E+K + Sbjct: 123 LVDLEAYLERKPAQLSGGQRQRVALARAIISEHPICLMDEPLSNLDARLRGEMRREIKAL 182 Query: 182 HQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGSPPM 241 QRL T +YVTHDQ+EAM++GD+V +M+DG I Q TP E+Y PA+ F A FIGSP M Sbjct: 183 QQRLGMTVIYVTHDQVEAMSMGDRVILMQDGRIVQDATPSELYERPASAFAAGFIGSPAM 242 Query: 242 NFVPLRLQRKDGRLVALLDSGQARCELALNTTEAGLEDRDVILGLRPEQIMLAAGEGDSA 301 N V L DG ++ G+ RC +A + E + LGLRPE+I L + A Sbjct: 243 NLVTLS-AAADGAVI----DGEPRCSVAPH------EAKGHWLGLRPEEIRLLPAD---A 288 Query: 302 SSIRAEVQVTEPTGPDTLVFVQLNDTKVCCRLAPDVAPQVGETLTLQFDPSKVLLFDANT 361 + AEV E G D++V +++ ++ RL + G LQ+ FDA+ Sbjct: 289 PGVPAEVIDAEYLGADSIVRLKVGSQQLRARLDGRPSLAAGSPCRLQWRRETAHFFDASD 348 Query: 362 GERL 365 G+RL Sbjct: 349 GQRL 352 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 396 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 398 Length adjustment: 31 Effective length of query: 355 Effective length of database: 367 Effective search space: 130285 Effective search space used: 130285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory