Align xylitol 2-dehydrogenase (EC 1.1.1.9) (characterized)
to candidate WP_086511871.1 BZY95_RS21175 zinc-dependent alcohol dehydrogenase
Query= reanno::WCS417:GFF3461 (359 letters) >NCBI__GCF_002151265.1:WP_086511871.1 Length = 389 Score = 113 bits (282), Expect = 1e-29 Identities = 86/286 (30%), Positives = 134/286 (46%), Gaps = 34/286 (11%) Query: 7 MQAVVCHGPKDYRLERIGKPQAR-ANELVIRIAACGICASDCKC-HSGAAMFWGGDNPWV 64 M+A+ HG D R E + P+ + +I +++C IC SD H GD Sbjct: 1 MKALCWHGKNDIRYETVPDPKIEHPRDAIINVSSCAICGSDLHLFHHFIPAMESGD---- 56 Query: 65 KAPVVPGHEFFGYVVEAGEGAEEHFEVAVGDKVIAEQIVPCGKCRFCKSGKYWMCEVHN- 123 V GHEF G V+E G E E+ VGD+V+ + CG+C C+ G + +CE N Sbjct: 57 ----VVGHEFMGEVMEVGN---ETRELKVGDRVVVPFTITCGECEQCRRGNFSLCERSNR 109 Query: 124 ---------------IFGFQREVA--EGGMAQYMRIPKTAIVH-KIPESVSLEDSALV-E 164 +FG+ GG A+Y+R+P H K+P+S+S E + + Sbjct: 110 NKALADKVFGHAGAGLFGYSHLTGGYAGGQAEYVRVPFADTTHVKVPDSLSDEQVLFLGD 169 Query: 165 PMACSIHTVNRGDIQLDDVVVIAGAGTLGLCMVQVAALKTPKKLVVIDMVDERLELAKKF 224 + DI+ D V I GAG +G V+ A L +++VVID V ERL +A+ Sbjct: 170 IFPTGWQAAVQCDIEPTDTVAIWGAGPVGQFCVRSAVLLGAEQVVVIDNVPERLAMAEAG 229 Query: 225 GADVVINPSRDNAREIINGLTDNYGCDVYIETTGVPAGVTQGLDLI 270 GA + I+ ++ + LT G + I+ G+ + V + LD + Sbjct: 230 GA-IAIDFDEESVLARLQELTRGKGPEKCIDAVGLESHVPRSLDSV 274 Lambda K H 0.322 0.139 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 389 Length adjustment: 30 Effective length of query: 329 Effective length of database: 359 Effective search space: 118111 Effective search space used: 118111 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory