Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_109968951.1 DK846_RS10730 ABC transporter ATP-binding protein
Query= uniprot:A0A165KQ08 (355 letters) >NCBI__GCF_003173355.1:WP_109968951.1 Length = 250 Score = 174 bits (440), Expect = 3e-48 Identities = 91/206 (44%), Positives = 132/206 (64%), Gaps = 6/206 (2%) Query: 27 VDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTEGEIRIGG------KNVVGMPPRDR 80 +D+ V PGE LIL+G +G GKST+LN+++GL EP +GEI + G K + PP +R Sbjct: 17 IDLTVNPGEVLILLGTNGSGKSTVLNLLSGLLEPDDGEIVLNGHVVFNAKQKIFSPPEER 76 Query: 81 DIAMVFQSYALYPTLSVADNIGFALEMRKMPKPERQKRIDEVAAMLQISHLLDRRPSQLS 140 +I VFQ+YAL+P +SV DNI + L+MRK+PK + +I L+I+H+ + R + LS Sbjct: 77 NIGYVFQNYALFPHMSVFDNIAYGLKMRKIPKEQIVSQIQRTLEDLEIAHVRNERVTNLS 136 Query: 141 GGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVEMRAEIKRLHQASGITSVYVTHDQV 200 GGQRQRVA+ RAL QP L L DEPL+ LD R ++R E++ S ++ VTH Sbjct: 137 GGQRQRVALARALIVQPHLLLLDEPLTALDPMAREKIRLELREQLVTSSHPAIMVTHSIK 196 Query: 201 EAMTLGSRIAVMKGGVVQQLGTPDEI 226 +A +G R+ +++ G V G PDE+ Sbjct: 197 DAQIIGDRVIILEKGTVIWKGKPDEL 222 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 250 Length adjustment: 26 Effective length of query: 329 Effective length of database: 224 Effective search space: 73696 Effective search space used: 73696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory