Align Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)
to candidate WP_109970253.1 DK846_RS17270 ABC transporter ATP-binding protein
Query= TCDB::Q72L52 (376 letters) >NCBI__GCF_003173355.1:WP_109970253.1 Length = 362 Score = 156 bits (395), Expect = 7e-43 Identities = 112/363 (30%), Positives = 177/363 (48%), Gaps = 23/363 (6%) Query: 4 VRLEHVWKRFGKVVAVKDFNLETEDGEFVVFVGPSGCGKTTTLRMIAGLEEISEGNI-YI 62 ++L+H+ K FG + + + ++E G+ +GPSG GKTT +R+I L+ S G I + Sbjct: 2 IKLDHISKSFGDRLILDNISVEIPSGKIFTIIGPSGQGKTTLMRLINLLDTPSSGQIIFN 61 Query: 63 GDRL--VNDVPPKDRDIAMVFQNYALYPHMNVYENMAFGLRLRRYPKDEIDRRVKEAARI 120 G L + ++ R + MVFQ + + VY N+A GL+ R KDEI +RV+E Sbjct: 62 GTSLEHIKNITEIRRQMGMVFQTPIAF-NETVYANLAMGLKFRGVSKDEIKKRVEEKINE 120 Query: 121 LKIEHLLNRKPRELSGGQRQRVAMGRAIVREPKVFLMDEPLSNLDAKLRVEMRAEIAKLQ 180 + + +RK R LSGG+ QRV++ R ++ P + L+DEP +NLD ++ I Sbjct: 121 IGLSGYEHRKARTLSGGEMQRVSLARVMITNPDLLLLDEPTANLDPVSTAKIEELIRYYN 180 Query: 181 RRLGVTTIYVTHDQVEAMTLGHRIVVMKDGEIQQVDTPLNLYDFPANRFVAGFIGSPSMN 240 R G T I +HD + L I VM G Q ++ P + VA FIG + Sbjct: 181 RTCGTTVIMSSHDLYQGQRLADIIAVMMGGRFVQSGETNQVFSEPCSADVARFIG---IR 237 Query: 241 FVRAGVEVQGEKVYLVAPGFRIRANAVLGSALKPYAGKEVWLGVRPE----HLGLKGYTT 296 + GV Q E + +I ++ A+ KEV + +RPE H G T+ Sbjct: 238 NILPGVATQLENGLI-----QIDLGGIIIYAVSSMTEKEVMVAIRPEEITVHTNESGKTS 292 Query: 297 IPEEENVLRGEVEVVEPLGAETEIHVAVNGTLLVAKVD----GHAPVKPGDKVELLADTQ 352 NVL G + +EP G + V+ NG +L ++V ++PG +V+L Sbjct: 293 ---ARNVLTGIITEIEPYGIINHVLVSCNGIILASQVTLQSVREMNLRPGLEVQLSFKAP 349 Query: 353 RLH 355 +H Sbjct: 350 SVH 352 Lambda K H 0.320 0.139 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 362 Length adjustment: 30 Effective length of query: 346 Effective length of database: 332 Effective search space: 114872 Effective search space used: 114872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory