Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate WP_027490801.1 LRK54_RS04500 acetyl ornithine aminotransferase family protein
Query= reanno::Putida:PP_4108 (416 letters) >NCBI__GCF_021560695.1:WP_027490801.1 Length = 444 Score = 260 bits (665), Expect = 5e-74 Identities = 158/421 (37%), Positives = 224/421 (53%), Gaps = 23/421 (5%) Query: 4 ESISQSIAIVHPITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATR 63 E IS S +P +SHGR EVWD DG R++DF+ GI V GH +P VV+A+Q A + Sbjct: 28 EVISPSYPRDYPFVMSHGRGTEVWDVDGNRFLDFMAGIAVCATGHAHPQVVKAVQDAAAK 87 Query: 64 LTHYAFNAAPHGPYLALMEQLSQFVPVSYPLAGMLTNSGAEAAENALKVARGATGKRAII 123 H + + H L E+L+ P+ P + SG EA E ALK+AR TG+ I Sbjct: 88 FLHISSDYW-HEEMTGLGERLAAVAPLGAPAMSFICQSGTEAVEGALKLARYVTGRPRFI 146 Query: 124 AFDGGFHGRTLATLNLNGKVAPYKQRVGELP--GPVYHLPYPSADTGVTC--EQALKAMD 179 F GGFHGRT +L+ + Y Q+ G P V H+PYP+ + +Q +D Sbjct: 147 GFLGGFHGRTFGSLSFTS--SKYTQQKGFSPTLAGVTHVPYPNPYRPLFAGDDQGAAVLD 204 Query: 180 ---RLFSVELAVEDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGF 236 LF + +VAA + EP+QGEGG+L F LR CDE GIL+I DE+QSG Sbjct: 205 YIRMLFQRSVPPSEVAAILIEPMQGEGGYLTPPDGFLAGLRALCDEHGILLIFDEVQSGI 264 Query: 237 GRTGQRFAFPRLGIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISC 296 GRTG+ FA G++PD++ AK + G+P+GAV+ +K +M+ +G G TY GNP++C Sbjct: 265 GRTGRMFACEHWGVQPDIITSAKGLGSGLPIGAVIAKKSIMSQWKRGAHGNTYGGNPVTC 324 Query: 297 AAALASLAQMTDENLATWGERQEQAIVSRYERWKASGLS---PYIGRLTGVGAMRGIEFA 353 AAA A+L +L G A V + + L P IG + G G G+E Sbjct: 325 AAANATL------DLVRGGLMDNAARVGDHFMARLRELQRDYPCIGEVRGKGLWIGMELI 378 Query: 354 NADG--SPAPAQLAKVMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQC 411 DG +PA A V++ A GLLL+ G + +R + PL + ++E + +L Sbjct: 379 EDDGKKTPATALCEAVVQRAFHNGLLLLSCGTS--TVRFMPPLNVSVGEVDEAIALLRSS 436 Query: 412 L 412 L Sbjct: 437 L 437 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 551 Number of extensions: 34 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 444 Length adjustment: 32 Effective length of query: 384 Effective length of database: 412 Effective search space: 158208 Effective search space used: 158208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory