Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate WP_092992765.1 BLP65_RS03760 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::Q72IB9 (516 letters) >NCBI__GCF_900102855.1:WP_092992765.1 Length = 454 Score = 179 bits (453), Expect = 2e-49 Identities = 140/444 (31%), Positives = 205/444 (46%), Gaps = 22/444 (4%) Query: 55 SLNPSAPSEVVGTTAKAGKAEAEAALEAAWKAFKTWKDWPQEDRSRLLLKAAALMRRRKR 114 S+NP A + + A + ++ L+ A W P + R+ L+ + +R ++ Sbjct: 5 SVNP-ATGKRLAEFAYWDAEKLDSVLQQVADATPGWAATPVKGRALLIRRLGETLREQRE 63 Query: 115 ELEATLVYEVGKNWVEASADVAEAIDFIEYYARAALRYRYPAVEVVPYPGEDNESFYVPL 174 +L A + E+GK EA ++ + +YYA + + A E + + Y PL Sbjct: 64 QLAAIITREMGKLIGEARGEIDKCAWLCDYYAESGPGFL--ADETLESDATRSLVAYQPL 121 Query: 175 GAGVVIAPWNFPV-AIFTGMIMGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEAGFPPGVV 233 G + + PWNFP +F + G +A GNT + K A + + +F EAGFP GV Sbjct: 122 GTVLAVMPWNFPFWQVFRFAVPGLLA-GNTGLLKHASNVPQCAKSIENLFIEAGFPEGVF 180 Query: 234 NFLPGVGEEVGAYLVEHPRTRFINFTGSLEVGLKIYEAAGRLAPGQTWFKRAYVETGGKD 293 L +G ++ R + + TGS G K+ AAG K++ +E GG D Sbjct: 181 RSLM-IGASQVEGVIADLRVQAVTLTGSDSAGRKVAAAAG------AHLKKSVLELGGSD 233 Query: 294 AIIVDETADFDLAAEGVVVSAYGFQGQKCSAASRLILTQGAYEPVLERVLKRAERLSVG- 352 +V E AD D AA V S + GQ C AA R IL E L R E L G Sbjct: 234 PFVVLEDADLDGAARAAVTSRFLNGGQSCIAAKRFILVDAVAENFLARFKAGVEALVPGD 293 Query: 353 PAEENPDLGPVVSAEQE----RKVLSYIEIGKNEGQLVLGGKRLEGEGYFIAPTVFTEVP 408 P E L P+ + R+V++ IE G + V G + LEGEG F A ++ V Sbjct: 294 PMTEQATLPPMARTDLRDDLHRQVIASIEQG---AEAVTGCRPLEGEGAFYAASILDRVE 350 Query: 409 PKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWARREFHVGN 468 P EE+FGPV V+R +D A+AL +AND+P+GL G V+S + E R G Sbjct: 351 PGMPAYSEELFGPVAIVLRARDEADALRIANDSPFGLGGSVWSADTQRGEAFARALECGC 410 Query: 469 LYFNRKITGALVGVQPFGGFKLSG 492 + N + PFGG K SG Sbjct: 411 AFVNGMVKSD--PRLPFGGIKQSG 432 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 516 Length of database: 454 Length adjustment: 34 Effective length of query: 482 Effective length of database: 420 Effective search space: 202440 Effective search space used: 202440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory