Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate WP_092996972.1 BLP65_RS11225 SDR family oxidoreductase
Query= BRENDA::Q4J9F2 (255 letters) >NCBI__GCF_900102855.1:WP_092996972.1 Length = 334 Score = 118 bits (295), Expect = 2e-31 Identities = 80/250 (32%), Positives = 124/250 (49%), Gaps = 7/250 (2%) Query: 6 LKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDR-LNQIVQELRGMGKEVLGVKA 64 L+ ++TG SGIGRA+A FA ++ + + L ED + + G + L + Sbjct: 87 LRGMKALITGGDSGIGRAVAVLFAREEADIAILYLNEDEDARETKSAVENEGGKCLEIAG 146 Query: 65 DVSKKKDVEEFVRRTFETYSRIDVLCNNAGIMDGVTPVAEVSDELWERVLAVNLYSAFYS 124 DV V RT E Y ++D+L NNA + + E+S+E ++ L NLY F+ Sbjct: 147 DVKAPAFCRYAVERTLEEYGQLDILVNNAAFQEHAASLEEISEEHFDETLRTNLYGYFHM 206 Query: 125 SRAVIPIMLKQGKGVIVNTASIAGIRGGFAGAPYTVAKHGLIGLTRSIAAHYGDQGIRAV 184 ++A +P LK G I+NT S GI G Y++ K G+ T+++A + + IR Sbjct: 207 AKAAVP-HLKPGSS-IINTGSETGIFGQPVLLDYSLTKGGIHAFTKALATNLIPKEIRVN 264 Query: 185 AVLPGTVKTNIGLGSSKPSELGMRTLTKLMSLSSRLAEPEDIANVIVFLASDEAS-FVNG 243 AV PG V T + P L T M R A+PE+++ VFLA+ S ++ G Sbjct: 265 AVAPGPVWTPLNPADRPPGTLSKFGATTDM---KRPAQPEEVSPAYVFLAAPSCSGYITG 321 Query: 244 DAVVVDGGLT 253 + V GG+T Sbjct: 322 TVIPVMGGVT 331 Lambda K H 0.318 0.135 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 334 Length adjustment: 26 Effective length of query: 229 Effective length of database: 308 Effective search space: 70532 Effective search space used: 70532 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory