Align Short-chain dehydrogenase/reductase SDR (characterized, see rationale)
to candidate WP_092996972.1 BLP65_RS11225 SDR family oxidoreductase
Query= uniprot:B2T9V3 (247 letters) >NCBI__GCF_900102855.1:WP_092996972.1 Length = 334 Score = 93.6 bits (231), Expect = 5e-24 Identities = 82/258 (31%), Positives = 121/258 (46%), Gaps = 31/258 (12%) Query: 4 RLAGKTALITAAGQGIGLATAELFAREGARVIA-----------TDIRIDGLAGKPVEAR 52 +L G ALIT GIG A A LFARE A + T ++ GK +E Sbjct: 86 KLRGMKALITGGDSGIGRAVAVLFAREEADIAILYLNEDEDARETKSAVENEGGKCLEIA 145 Query: 53 KLDVRDDA----AIKALAAEIGAVDVLFNCAGFV-HAGNILECSEEDWDFAFDLNVKAMY 107 DV+ A A++ E G +D+L N A F HA ++ E SEE +D N+ + Sbjct: 146 G-DVKAPAFCRYAVERTLEEYGQLDILVNNAAFQEHAASLEEISEEHFDETLRTNLYGYF 204 Query: 108 RMIRAFLPAMLDKGGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGV 167 M +A +P + K G SIIN S + + G P YS +K + TK++A + I + + Sbjct: 205 HMAKAAVPHL--KPGSSIINTGSE-TGIFGQPVLLDYSLTKGGIHAFTKALATNLIPKEI 261 Query: 168 RCNAICPGTVASPSLEQRIVAQAQAQGATLDAVQAAFVARQPMGRIGKPEEIAALALYLG 227 R NA+ PG V +P + A TL + F A M R +PEE++ ++L Sbjct: 262 RVNAVAPGPVWTP------LNPADRPPGTL----SKFGATTDMKRPAQPEEVSPAYVFLA 311 Query: 228 SDE-SSFTTGHAHVIDGG 244 + S + TG + GG Sbjct: 312 APSCSGYITGTVIPVMGG 329 Lambda K H 0.320 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 334 Length adjustment: 26 Effective length of query: 221 Effective length of database: 308 Effective search space: 68068 Effective search space used: 68068 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory