Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate WP_092996195.1 BLP65_RS09975 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Phaeo:GFF2754 (331 letters) >NCBI__GCF_900102855.1:WP_092996195.1 Length = 338 Score = 353 bits (905), Expect = e-102 Identities = 183/337 (54%), Positives = 239/337 (70%), Gaps = 7/337 (2%) Query: 1 MTALQLTNVCKSFGPVEVLKDINLTVEDGEFVVFVGPSGCGKSTLLRVISGLEDATAGEI 60 M ++ L NV K FG EV+K I+LT+E+G VFVGPSGCGKSTLLR+I+GLE+ T+G+I Sbjct: 1 MASVDLENVTKRFGRTEVIKGIDLTIENGRLTVFVGPSGCGKSTLLRLIAGLEEVTSGKI 60 Query: 61 SIGGQTVTTTPPAKRGIAMVFQSYALYPHLSVRENMALALKQERQPKEEIAARVAEASRM 120 IG + VT PPA+RG+AMVFQSYALYPH+ V +NMA LK R + EI RV A+R+ Sbjct: 61 HIGDENVTDWPPAERGVAMVFQSYALYPHMKVFDNMAFGLKISRTKRNEIEERVRHAARI 120 Query: 121 LSLEDYLDRRPSELSGGQRQRVAIGRAVVREPKLFLFDEPLSNLDAALRMNTRLEIARLH 180 L +E L+ +P ELSGGQRQRVAIGRA+VREPK+FLFDEPLSNLDA+LR+ RLE+A L Sbjct: 121 LRIEPLLNHKPGELSGGQRQRVAIGRAIVREPKVFLFDEPLSNLDASLRVQMRLELASLQ 180 Query: 181 RQLSASMIYVTHDQIEAMTLADKIVVLRDGRIEQVGTPMELYNNPANRFVAEFIGAPAMN 240 R+L A+M+YVTHDQ EAMTL IVVL +GR+EQVGTP+E+Y NPANRFVA FIG+P MN Sbjct: 181 RELDATMVYVTHDQTEAMTLGHTIVVLNEGRVEQVGTPLEVYRNPANRFVAGFIGSPEMN 240 Query: 241 FVPAQRLGGNP------GQFIGIRPEYARISPVGPLAGEVIHVEKLGGDTNILVDMGEDL 294 F+ + P +GIRPE+ + GPL G++ VE+LG ++ + +++ + Sbjct: 241 FLELEEKLPIPKPPLPEAVTLGIRPEHVILGD-GPLQGKITLVERLGSESFLHLELPGEE 299 Query: 295 TFTARLFGQHDTNVGETLQFDFDPANCLSFDEAGQRI 331 TAR G G+T+ +F + FD+ G+ I Sbjct: 300 RVTARASGDLSARPGDTMAMEFPSEHLHFFDDDGRTI 336 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 338 Length adjustment: 28 Effective length of query: 303 Effective length of database: 310 Effective search space: 93930 Effective search space used: 93930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory