Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_092996195.1 BLP65_RS09975 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >NCBI__GCF_900102855.1:WP_092996195.1 Length = 338 Score = 154 bits (388), Expect = 3e-42 Identities = 82/222 (36%), Positives = 127/222 (57%), Gaps = 6/222 (2%) Query: 48 VNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREF 107 + + L+I G + V +G SG GKSTL+R L + TSG I + E++ Sbjct: 19 IKGIDLTIENGRLTVFVGPSGCGKSTLLRLIAGLEEVTSGKIHIGDENVTDWPP------ 72 Query: 108 RRHKISMVFQSFGLLPHKSVLDNVAYGLKVRGESKQVCAERALHWINTVGLKGYENKYPH 167 ++MVFQS+ L PH V DN+A+GLK+ + ER H + ++ N P Sbjct: 73 AERGVAMVFQSYALYPHMKVFDNMAFGLKISRTKRNEIEERVRHAARILRIEPLLNHKPG 132 Query: 168 QLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITH 227 +LSGG RQRV + RA+ + + L DE S LD +R +M+ +L LQ+ L T+V++TH Sbjct: 133 ELSGGQRQRVAIGRAIVREPKVFLFDEPLSNLDASLRVQMRLELASLQRELDATMVYVTH 192 Query: 228 DLDEAVRIGNRIAILKDGKLIQVGTPREILHSPADEYVDRFV 269 D EA+ +G+ I +L +G++ QVGTP E+ +PA+ +V F+ Sbjct: 193 DQTEAMTLGHTIVVLNEGRVEQVGTPLEVYRNPANRFVAGFI 234 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 338 Length adjustment: 27 Effective length of query: 249 Effective length of database: 311 Effective search space: 77439 Effective search space used: 77439 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory