Align ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized)
to candidate WP_092996195.1 BLP65_RS09975 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= BRENDA::P68187 (371 letters) >NCBI__GCF_900102855.1:WP_092996195.1 Length = 338 Score = 354 bits (909), Expect = e-102 Identities = 189/359 (52%), Positives = 247/359 (68%), Gaps = 26/359 (7%) Query: 1 MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL 60 MASV L+NVTK +G V K I+L I G VFVGPSGCGKSTLLR+IAGLE +TSG + Sbjct: 1 MASVDLENVTKRFGRTEVIKGIDLTIENGRLTVFVGPSGCGKSTLLRLIAGLEEVTSGKI 60 Query: 61 FIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV 120 IG++ + D PPAERGV MVFQSYALYPH+ V +NM+FGLK++ K+ I +RV A + Sbjct: 61 HIGDENVTDWPPAERGVAMVFQSYALYPHMKVFDNMAFGLKISRTKRNEIEERVRHAARI 120 Query: 121 LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLH 180 L++ LL+ KP LSGGQRQRVAIGR +V EP VFL DEPLSNLDA+LRVQMR+E++ L Sbjct: 121 LRIEPLLNHKPGELSGGQRQRVAIGRAIVREPKVFLFDEPLSNLDASLRVQMRLELASLQ 180 Query: 181 KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMN 240 + L TM+YVTHDQ EAMTL IVVL+ GRV QVG PLE+Y PA+RFVAGFIGSP+MN Sbjct: 181 RELDATMVYVTHDQTEAMTLGHTIVVLNEGRVEQVGTPLEVYRNPANRFVAGFIGSPEMN 240 Query: 241 FLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVIL 300 FL +++ +LP+P LP ++LGIRPEH++ + D L Sbjct: 241 FL----------ELEEKLPIPKPP---LP---------EAVTLGIRPEHVI---LGDGPL 275 Query: 301 EGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDG 359 +G++ +VE+LG+E+ +H+++P + + R + + G T A+ P E H F +DG Sbjct: 276 QGKITLVERLGSESFLHLELPG-EERVTARASGDLSARPGDTMAMEFPSEHLHFFDDDG 333 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 338 Length adjustment: 29 Effective length of query: 342 Effective length of database: 309 Effective search space: 105678 Effective search space used: 105678 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory