Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_092996195.1 BLP65_RS09975 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= BRENDA::Q8NMV1 (376 letters) >NCBI__GCF_900102855.1:WP_092996195.1 Length = 338 Score = 284 bits (727), Expect = 2e-81 Identities = 163/323 (50%), Positives = 209/323 (64%), Gaps = 25/323 (7%) Query: 1 MATVTFKDASLSYPGAKEPTVKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDG 60 MA+V ++ + + + +K +L I +G V VGPSGCGKST LR++AGLE VT G Sbjct: 1 MASVDLENVTKRF--GRTEVIKGIDLTIENGRLTVFVGPSGCGKSTLLRLIAGLEEVTSG 58 Query: 61 AIFIGDKDVTHVAPRDRDIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAA 120 I IGD++VT P +R +AMVFQ+YALYPHM V +NM F LKI+ ++EI +RV AA Sbjct: 59 KIHIGDENVTDWPPAERGVAMVFQSYALYPHMKVFDNMAFGLKISRTKRNEIEERVRHAA 118 Query: 121 ATLGLTEFLERKPKALSGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAA 180 L + L KP LSGGQRQRVA+GRAIVR P+VFL DEPLSNLDA LRVQ R ++A+ Sbjct: 119 RILRIEPLLNHKPGELSGGQRQRVAIGRAIVREPKVFLFDEPLSNLDASLRVQMRLELAS 178 Query: 181 LQRKLGVTTVYVTHDQTEALTMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPA 240 LQR+L T VYVTHDQTEA+T+G I VL +G ++QVG P E+Y PAN FVAGFIGSP Sbjct: 179 LQRELDATMVYVTHDQTEAMTLGHTIVVLNEGRVEQVGTPLEVYRNPANRFVAGFIGSPE 238 Query: 241 MNLGTFSVKDGDATSGHARIKLSPETLAAMTPEDNGRITIGFRPEALEIIPEGESTDLSI 300 MN ++L E L P +T+G RPE + I+ +G + Sbjct: 239 MNF----------------LELE-EKLPIPKPPLPEAVTLGIRPEHV-ILGDG-----PL 275 Query: 301 PIKLDFVEELGSDSFLYGKLVGE 323 K+ VE LGS+SFL+ +L GE Sbjct: 276 QGKITLVERLGSESFLHLELPGE 298 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 338 Length adjustment: 29 Effective length of query: 347 Effective length of database: 309 Effective search space: 107223 Effective search space used: 107223 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory