Align BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized)
to candidate WP_092996195.1 BLP65_RS09975 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q93A35 (328 letters) >NCBI__GCF_900102855.1:WP_092996195.1 Length = 338 Score = 172 bits (437), Expect = 8e-48 Identities = 86/239 (35%), Positives = 148/239 (61%), Gaps = 6/239 (2%) Query: 2 IRFDNVSKKYSDDKTAAVNNVTLDIKDGEFFVFIGPSGCGKTTTLKMINRLIPLTTGTIY 61 + +NV+K++ +T + + L I++G VF+GPSGCGK+T L++I L +T+G I+ Sbjct: 4 VDLENVTKRFG--RTEVIKGIDLTIENGRLTVFVGPSGCGKSTLLRLIAGLEEVTSGKIH 61 Query: 62 INEKRISDYDIHELRWDIGYVLQQIALFPHMTIEENIAIVPELKKWSKEKIHDRITELLD 121 I ++ ++D+ E + V Q AL+PHM + +N+A ++ + + +I +R+ Sbjct: 62 IGDENVTDWPPAER--GVAMVFQSYALYPHMKVFDNMAFGLKISRTKRNEIEERVRHAAR 119 Query: 122 SVGLDPESYRHRKPAELSGGEQQRVGVVRALAADPGIILMDEPFSALDPISRQRLQQDIS 181 + ++P + KP ELSGG++QRV + RA+ +P + L DEP S LD R +++ +++ Sbjct: 120 ILRIEP--LLNHKPGELSGGQRQRVAIGRAIVREPKVFLFDEPLSNLDASLRVQMRLELA 177 Query: 182 ALQKKIKKTIVFVTHDMQEALALGDRICVMQGGEIVQVATPQEIMKNPENDFVKDFLAS 240 +LQ+++ T+V+VTHD EA+ LG I V+ G + QV TP E+ +NP N FV F+ S Sbjct: 178 SLQRELDATMVYVTHDQTEAMTLGHTIVVLNEGRVEQVGTPLEVYRNPANRFVAGFIGS 236 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 338 Length adjustment: 28 Effective length of query: 300 Effective length of database: 310 Effective search space: 93000 Effective search space used: 93000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory