Align spermidine/putrescine ABC transporter, permease protein PotB (characterized)
to candidate WP_092349403.1 BLU87_RS13050 ABC transporter permease
Query= CharProtDB::CH_088337 (275 letters) >NCBI__GCF_900107645.1:WP_092349403.1 Length = 287 Score = 171 bits (434), Expect = 1e-47 Identities = 91/270 (33%), Positives = 159/270 (58%), Gaps = 10/270 (3%) Query: 2 IVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKMVFTLDNYTRLL-DPLYFEVLLHSLN 60 + ++ WL+L + LP++ ++ SF +D + + V+TL NY +P+Y+ L + Sbjct: 15 LTPVLCWLLLLIVLPHIDLLRMSFGGEND--YGEHVWTLQNYRNFFTEPIYWNTFLRTAI 72 Query: 61 MALIATLACLVLGYPFAWFLAKLPHKVRP----LLLFLLIVPFWTNSLIRIYGLKIFLST 116 ++I T+ +L P A+++ K+ VRP ++ +L++PFW + L+R+YG I L Sbjct: 73 FSIITTIITFLLAMPVAFYIVKV---VRPRFQGAMVLMLLLPFWVSELVRVYGWMILLRE 129 Query: 117 KGYLNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARD 176 G +N FLL GV+D P+ +++ + +I+GLVY + FMV+P+ S++E LD L+EAA D Sbjct: 130 SGVINHFLLKFGVVDRPVEMLYNDATMIMGLVYTSMLFMVVPIISAMESLDDSLIEAAHD 189 Query: 177 LGASKLQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLN 236 LG+ KL + +II+P PGI +G ++V + +G + +LMGG +L I QF+ Sbjct: 190 LGSGKLVIWYKIILPHCKPGITSGSIVVFMLVLGNYLTPNLMGGKNSLWFTEQIYNQFIA 249 Query: 237 IRDWPFGAATSITLTIVMGLMLLVYWRASR 266 +W GAA L ++ L++ + + SR Sbjct: 250 SFNWNQGAAFGFLLLLLSSLIIWIGLKLSR 279 Lambda K H 0.333 0.148 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 287 Length adjustment: 26 Effective length of query: 249 Effective length of database: 261 Effective search space: 64989 Effective search space used: 64989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory