GapMind for catabolism of small carbon sources

 

Protein WP_092057925.1 in Desulfuromonas acetexigens DSM 1397

Annotation: NCBI__GCF_900111775.1:WP_092057925.1

Length: 366 amino acids

Source: GCF_900111775.1 in NCBI

Candidate for 39 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA lo PotG aka B0855, component of Putrescine porter (characterized) 31% 94% 161.8 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 35% 84% 160.2 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 35% 88% 160.2 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 35% 84% 160.2 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 38% 60% 159.5 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 33% 88% 154.1 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 34% 84% 152.9 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 32% 79% 152.5 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 32% 79% 152.5 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 34% 90% 152.1 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 35% 78% 151.8 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 31% 90% 151.4 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-cellobiose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 31% 87% 147.9 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-glucose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 31% 87% 147.9 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
lactose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 31% 87% 147.9 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-maltose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 31% 87% 147.9 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 31% 87% 147.9 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 35% 62% 147.9 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
sucrose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 31% 87% 147.9 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
trehalose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 31% 87% 147.9 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 31% 90% 147.1 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 30% 86% 146.7 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 32% 83% 145.6 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 32% 83% 145.6 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 32% 83% 145.6 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 32% 83% 145.6 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 32% 83% 145.6 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 32% 83% 145.6 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 32% 83% 145.6 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 32% 83% 145.6 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 32% 83% 145.6 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 32% 81% 144.1 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 34% 72% 139 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 31% 89% 136 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 35% 80% 132.5 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 34% 70% 125.9 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
citrate catabolism fecE lo iron(III) dicitrate transport ATP-binding protein FecE (characterized) 34% 87% 107.1 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
D-alanine catabolism AZOBR_RS08245 lo Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 33% 52% 62 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6
L-proline catabolism AZOBR_RS08245 lo Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 33% 52% 62 CysA aka B2422, component of Sulfate/thiosulfate porter 37% 175.6

Sequence Analysis Tools

View WP_092057925.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNLSVAIRHEGPLLDFAAELPEGRITALVGPSGSGKTSILHAIAGLLRVRQARIRLGEAV
WDDERVHLPTRLRPIGLVSQHYGLFPHLTAQANVEMSLTHLPKGQRRERARHYLALARVE
GLEGRFPHELSGGQRQRVALARAIARDPQLLLLDEPFSAVDRSTRQRLYIELRRLHAELR
TTILLVTHDLDEAARMADHLVLLRHGRLLQAGPTAAVLARPASVSAARLLDIPNVFAGEF
IGTDAEGAALLNWGAHRLRLTPAPDVAVGTTVRWAVLPSNLLLVRPDKPWGEHLENPIPG
RVCEVLELGGEALVWVVPDGLPETRMQMRIPVRSLRRSPLQVGDPLTLCLRAADIVPLAD
APAHEP

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory