Align Fructokinase; D-fructose kinase; Manno(fructo)kinase; EC 2.7.1.4 (characterized)
to candidate WP_092057054.1 BQ4888_RS10480 ROK family protein
Query= SwissProt::P23917 (302 letters) >NCBI__GCF_900111775.1:WP_092057054.1 Length = 318 Score = 117 bits (294), Expect = 3e-31 Identities = 96/319 (30%), Positives = 147/319 (46%), Gaps = 36/319 (11%) Query: 3 IGIDLGGTKTEVIALGDAGEQLYRHRLPTPRD-DYRQTIETIATLVD---MAEQATGQRG 58 +GIDLGGT +G G R PT DY +E A +D QA G + Sbjct: 6 VGIDLGGTNCRAALVGPQGRIGELLRRPTRMGADYAAWLEDFAGGIDELLRQGQALGLKV 65 Query: 59 T-VGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDG 117 T VGMG PG I+ V + N L+G+P DL+ RLQ V +ANDAN +A EA+ G Sbjct: 66 TAVGMGAPGLIALDGTVTTSPNLPALDGRPLAADLAERLQLPVVVANDANAIAWGEALFG 125 Query: 118 AAAGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYREEVPCY 177 A + + +GTG G G+ + R +G +G AGE GH W + R PC Sbjct: 126 AGRDFSSFIGLTLGTGVGGGLVLDRRLWLGADGAAGEVGH----WTVVPDGR-----PCG 176 Query: 178 CGKQGCIETFISGTGFAMDYR------------RLSGHALKGSEIIRLVEESDPVAELAL 225 CG +GC+E + S A+ R +++ L ++ + D +A L Sbjct: 177 CGNRGCLEQYASARALAVLARERIAAGEPSALAQIAAGELTSRQVGDAARQGDALALAVL 236 Query: 226 RRYELRLAKSLAHVVNILDPD-VIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPVRK- 283 L + L + N+L+ D ++ GG + + D ++ + + +++ VF P R+ Sbjct: 237 EEAGGYLGQVLGGIANLLNLDGAVIAGGAVDSFDLMHPAILRELRRHVFA----VPGRRL 292 Query: 284 ----AKHGDSSGVRGAAWL 298 + D +G+ GAA L Sbjct: 293 VVVPGQLADEAGILGAAAL 311 Lambda K H 0.318 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 318 Length adjustment: 27 Effective length of query: 275 Effective length of database: 291 Effective search space: 80025 Effective search space used: 80025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory