Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_092057890.1 BQ4888_RS13990 ATP-binding cassette domain-containing protein
Query= TCDB::G3LHY9 (356 letters) >NCBI__GCF_900111775.1:WP_092057890.1 Length = 254 Score = 104 bits (259), Expect = 3e-27 Identities = 73/224 (32%), Positives = 118/224 (52%), Gaps = 6/224 (2%) Query: 25 LKEVDHEWNDGGAYALLGPSGCGKTTLLNIISGLLQPSHGRILFDGKDVTNLSTQS--RN 82 L+ +D G ++GPSG GK+TLL +++ L P GRIL G D+ +L + R Sbjct: 28 LRGIDLTVPAGCLMVVVGPSGGGKSTLLRLLNRLEDPDAGRILLSGVDIGSLDPLALRRR 87 Query: 83 IAQVFQFPVIYDTMTVYDNLAFPLRNRGVAEADVDRR-VRDILEMIDL-ASWARRKAQGL 140 +A V Q +YD TV DNL P RG+ + D VR +L++ L R+A+ L Sbjct: 88 VAAVPQVSFMYDG-TVLDNLRRPFVFRGLPQPAADSEDVRRVLDLCRLPGDLLPRQARSL 146 Query: 141 TADQKQKISLGRGLVRNDVNAILFDEPLTVIDPHMKWVLRSQLKRLHKQFGFTMVYVTHD 200 + Q+Q+++L R L+ +L DEP + +D L L+ + ++ T+V +THD Sbjct: 147 SIGQQQRLALARVLLTGP-GVLLLDEPTSALDRPTADQLGQSLRDIRREERLTLVMLTHD 205 Query: 201 QTEALTFAEKVVVMYDGQIVQIGTPAELFERPSHTFVGYFIGSP 244 A A++ + +G+I++ GT A+ FE P + F+ SP Sbjct: 206 LRLAQRVADRAAFLENGRILEEGTAADFFENPRADALRRFLASP 249 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 254 Length adjustment: 27 Effective length of query: 329 Effective length of database: 227 Effective search space: 74683 Effective search space used: 74683 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory