Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_092058681.1 BQ4888_RS16490 ATP-binding cassette domain-containing protein
Query= TCDB::G3LHY9 (356 letters) >NCBI__GCF_900111775.1:WP_092058681.1 Length = 329 Score = 94.0 bits (232), Expect = 5e-24 Identities = 64/211 (30%), Positives = 110/211 (52%), Gaps = 10/211 (4%) Query: 35 GGAYALLGPSGCGKTTLLNIISGLLQPSHGRILFDGKDVTNLSTQS-----RNIAQVFQF 89 G L+G SGCGK+T +I LL+ G++LF G+D+ LS R++ +FQ Sbjct: 41 GETLGLVGESGCGKSTAGRLILRLLEADEGQVLFRGQDLLKLSPGRMRPLRRDLQMIFQD 100 Query: 90 PV--IYDTMTVYDNLAFPLRNRGVAEADVDRR-VRDILEMIDL-ASWARRKAQGLTADQK 145 P + M V D + PLR G+A+ R V +LE + L A R + Q+ Sbjct: 101 PYSSLNPRMKVGDIVGEPLRIHGLAKGRKLREDVTALLERVGLGAEHYDRYPHEFSGGQR 160 Query: 146 QKISLGRGLVRNDVNAILFDEPLTVIDPHMKWVLRSQLKRLHKQFGFTMVYVTHDQTEAL 205 Q++ + R L + I+ DEP++ +D ++ + + L+ L ++FG T +++ HD + Sbjct: 161 QRVGIARALAVRP-SLIIADEPVSALDLSIQAQVVNLLQDLQQEFGLTYLFIAHDLSVIE 219 Query: 206 TFAEKVVVMYDGQIVQIGTPAELFERPSHTF 236 +++V VMY G+IV++ L+ P H + Sbjct: 220 HISDRVAVMYLGRIVELAPAEALYHAPRHPY 250 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 329 Length adjustment: 29 Effective length of query: 327 Effective length of database: 300 Effective search space: 98100 Effective search space used: 98100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory